Plant FIBer expression Database

Lus10037442 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48360 99 / 7e-25 zinc ion binding;nucleic acid binding;hydrolases, acting on acid anhydrides, in phosphorus-containing anhydrides (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041269
[exp]
137 / 3e-38 AT1G48360 864 / 0.0 zinc ion binding;nucleic acid binding;hydrolases, acting on acid anhydrides, in phosphorus-containing anhydrides (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G233800
[exp]
111 / 3e-29 AT1G48360 964 / 0.0 zinc ion binding;nucleic acid binding;hydrolases, acting on acid anhydrides, in phosphorus-containing anhydrides (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10037442 pacid=23152390 polypeptide=Lus10037442 locus=Lus10037442.g ID=Lus10037442.BGIv1.0 annot-version=v1.0
ATGCTCAGCCCAAGCCTGCCAAGATCAATTCTGGCAAAGACTGGAACTTGCGTCAAGATAACTGCAAAAGCTGAGTCCCTTATCTGGCGCGCTGAGAGAC
TTTTCTTTCTGAACGGGGAGCAGGATCTCAGAGCATTTCTACTGGTAGATTTGGGAGTAGTCAAGTATCCTAGTTACAAGTGCATAATATCTCAACAAAT
ATTTTTGTTCAGGCATTCTCTCTCCGAACTTCGAGCTGTAGTGACTTGCACAGGCGGACCTTGTCTGGCTTCACTGTGCCGAGTTCTAGCTGAAGATTAC
CGGAGCTGGAGCAGTGGGATGCCGGATTTACTGCTGTGGAGGTTCCATCAAGTGTCCTACAGAGGTGAAGTGAAGCTTATGGTTTCTCCACGTACAAATC
AACCCATTTAA
AA sequence
>Lus10037442 pacid=23152390 polypeptide=Lus10037442 locus=Lus10037442.g ID=Lus10037442.BGIv1.0 annot-version=v1.0
MLSPSLPRSILAKTGTCVKITAKAESLIWRAERLFFLNGEQDLRAFLLVDLGVVKYPSYKCIISQQIFLFRHSLSELRAVVTCTGGPCLASLCRVLAEDY
RSWSSGMPDLLLWRFHQVSYRGEVKLMVSPRTNQPI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48360 zinc ion binding;nucleic acid ... Lus10037442
[exp]
0 1
AT4G24690 AtNBR1 Arabidopsis thaliana next to B... Lus10019471
[exp]
1.7 0.7820
AT5G15280 Pentatricopeptide repeat (PPR)... Lus10015373
[exp]
5.2 0.7517
AT2G21090 Pentatricopeptide repeat (PPR-... Lus10019213
[exp]
7.7 0.7860
AT3G24530 AAA-type ATPase family protein... Lus10005293
[exp]
8.9 0.8266
AT2G30860 GLUTTR, ATGSTF7... glutathione S-transferase PHI ... Lus10005634
[exp]
10.7 0.7395
AT5G06410 DNAJ heat shock N-terminal dom... Lus10033940
[exp]
11.0 0.7449
AT4G37460 SRFR1 SUPPRESSOR OF RPS4-RLD 1, Tetr... Lus10014863
[exp]
11.5 0.7820
AT2G32760 unknown protein Lus10022575
[exp]
15.9 0.7479
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10011716
[exp]
16.6 0.7711
AT1G64620 DOF AtDof1,8 Dof-type zinc finger DNA-bindi... Lus10033218
[exp]
22.4 0.7480

Lus10037442 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.