Lus10037443 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G72430 101 / 2e-28 SAUR-like auxin-responsive protein family (.1)
AT1G17345 99 / 3e-27 SAUR-like auxin-responsive protein family (.1)
AT5G20820 76 / 1e-18 SAUR-like auxin-responsive protein family (.1)
AT3G12955 54 / 4e-10 SAUR-like auxin-responsive protein family (.1)
AT4G34760 46 / 4e-07 SAUR-like auxin-responsive protein family (.1)
AT2G21220 42 / 9e-06 SAUR-like auxin-responsive protein family (.1)
AT5G20810 42 / 2e-05 SAUR-like auxin-responsive protein family (.1.2)
AT3G43120 42 / 3e-05 SAUR-like auxin-responsive protein family (.1)
AT1G16510 41 / 5e-05 SAUR-like auxin-responsive protein family (.1)
AT5G50760 41 / 7e-05 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013181 203 / 1e-68 AT1G72430 119 / 9e-36 SAUR-like auxin-responsive protein family (.1)
Lus10031790 61 / 2e-12 AT3G12955 98 / 8e-27 SAUR-like auxin-responsive protein family (.1)
Lus10012189 43 / 5e-06 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1)
Lus10007553 43 / 8e-06 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1)
Lus10034507 42 / 2e-05 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10024326 41 / 4e-05 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1)
Lus10012432 40 / 6e-05 AT1G75580 164 / 9e-54 SAUR-like auxin-responsive protein family (.1)
Lus10033161 40 / 0.0001 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Lus10023970 40 / 0.0001 AT1G29450 97 / 2e-26 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G071000 110 / 5e-32 AT1G72430 126 / 9e-39 SAUR-like auxin-responsive protein family (.1)
Potri.001G164300 91 / 2e-24 AT1G72430 108 / 2e-31 SAUR-like auxin-responsive protein family (.1)
Potri.006G137000 90 / 4e-24 AT5G20820 135 / 3e-42 SAUR-like auxin-responsive protein family (.1)
Potri.001G458000 61 / 2e-12 AT3G12955 86 / 3e-22 SAUR-like auxin-responsive protein family (.1)
Potri.011G143400 60 / 3e-12 AT3G12955 91 / 2e-24 SAUR-like auxin-responsive protein family (.1)
Potri.004G164400 46 / 3e-07 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
Potri.009G126000 45 / 9e-07 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1)
Potri.002G024300 42 / 7e-06 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1)
Potri.005G237200 42 / 1e-05 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1)
Potri.006G211000 42 / 2e-05 AT2G36210 130 / 3e-40 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10037443 pacid=23167008 polypeptide=Lus10037443 locus=Lus10037443.g ID=Lus10037443.BGIv1.0 annot-version=v1.0
ATGGCCAAGGTCGGAAAGCTCACCAAGCTAAAATCCGCCATCAAGAGGTGGCCCTCTTTCACCACCTCCAAGCAACACCATTCATCCTCCTCCTCCTCCA
TGGACCGCCATGTCGACCACCGCCAGCAGGAAGAAGAAGACTCCGATGATCATAGTCATCATGATCTCCACCAGGTGTATGTCGGGAAGTCGCGGCGGCG
GTACCTGCTGACGTCGGAGGTGATGTGCCATCCCCTGTTTCAGGAACTGATGCAGAGGTCAGGCGGGTTCGACGGCGACGGCAACGTTGTTGTCAGGAGC
GAGGTGGTTCTGTTCGAGCATTTGCTTTGGATGATTAACCAGAATTGCGGCGGCGGCGGAGAGGCGGCGGTATCTGGGCCGATGGAGGATTTGGTCGGAT
TCTATTGCTGCTGA
AA sequence
>Lus10037443 pacid=23167008 polypeptide=Lus10037443 locus=Lus10037443.g ID=Lus10037443.BGIv1.0 annot-version=v1.0
MAKVGKLTKLKSAIKRWPSFTTSKQHHSSSSSSMDRHVDHRQQEEEDSDDHSHHDLHQVYVGKSRRRYLLTSEVMCHPLFQELMQRSGGFDGDGNVVVRS
EVVLFEHLLWMINQNCGGGGEAAVSGPMEDLVGFYCC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G72430 SAUR-like auxin-responsive pro... Lus10037443 0 1
AT2G41905 unknown protein Lus10026313 3.9 0.7857
AT4G36750 Quinone reductase family prote... Lus10014325 6.9 0.7832
AT5G16220 Octicosapeptide/Phox/Bem1p fam... Lus10033570 10.4 0.7473
Lus10031697 12.1 0.7679
AT2G21170 PDTPI, TIM PLASTID ISOFORM TRIOSE PHOSPHA... Lus10012171 16.5 0.7712
AT1G05780 Vacuolar ATPase assembly integ... Lus10033833 23.2 0.7749
AT5G13430 Ubiquinol-cytochrome C reducta... Lus10041870 24.9 0.7694
AT5G09810 ACT2/7, ACT7 actin 7 (.1) Lus10006783 25.3 0.7448
AT1G60490 PI3K, ATVPS34 PHOSPATIDYLINOSITOL 3-KINASE, ... Lus10030605 30.3 0.7690
AT3G11760 unknown protein Lus10029364 34.8 0.6650

Lus10037443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.