Lus10037452 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G72340 94 / 5e-24 NagB/RpiA/CoA transferase-like superfamily protein (.1)
AT1G53900 89 / 8e-22 Eukaryotic translation initiation factor 2B (eIF-2B) family protein (.1)
AT1G53880 89 / 8e-22 Eukaryotic translation initiation factor 2B (eIF-2B) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003938 124 / 5e-35 AT1G53900 597 / 0.0 Eukaryotic translation initiation factor 2B (eIF-2B) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G163300 89 / 4e-22 AT1G53900 589 / 0.0 Eukaryotic translation initiation factor 2B (eIF-2B) family protein (.1)
Potri.003G072100 83 / 7e-20 AT1G53900 587 / 0.0 Eukaryotic translation initiation factor 2B (eIF-2B) family protein (.1)
PFAM info
Representative CDS sequence
>Lus10037452 pacid=23167251 polypeptide=Lus10037452 locus=Lus10037452.g ID=Lus10037452.BGIv1.0 annot-version=v1.0
ATGATGTGGAAGAGAACGGCCTCTTTCATCCTCGACAACCGCCAAAAACCACCGCACCCGCCATACGACGCCGCAGAAGTCGTCTCCCGCTCTTCTCGAC
CACCTCCTTCCACATCCATGGCCGATCCCAGCCCTAACCCAGCCGCCAAAATCTCCGCTTACTACCAGGCCCGCGCCGCCCACCACGGCGTCATCTCCAG
CGACTGGCTCGCCCAGGCCCAGGCCGCCGTCGGCACCCATCCCGACGCCCCCGACGGAGACGACGATAAACCTCAGGGCCCTCCTATTGACAAGCCGTTC
AGCGTCATAGACGAGTTCAATAATTGGCGCAAGCAGCCTGATGGTTTTTAA
AA sequence
>Lus10037452 pacid=23167251 polypeptide=Lus10037452 locus=Lus10037452.g ID=Lus10037452.BGIv1.0 annot-version=v1.0
MMWKRTASFILDNRQKPPHPPYDAAEVVSRSSRPPPSTSMADPSPNPAAKISAYYQARAAHHGVISSDWLAQAQAAVGTHPDAPDGDDDKPQGPPIDKPF
SVIDEFNNWRKQPDGF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G53900 Eukaryotic translation initiat... Lus10037452 0 1
AT2G28380 DRB2 dsRNA-binding protein 2 (.1) Lus10021471 2.2 0.8234
AT3G47620 TCP AtTCP14, TCP14 "TEOSINTE BRANCHED, cycloidea ... Lus10013814 6.3 0.7760
AT1G65720 unknown protein Lus10020795 11.6 0.7381
AT5G18110 NCBP novel cap-binding protein (.1) Lus10020282 17.7 0.7119
AT2G45590 Protein kinase superfamily pro... Lus10036533 18.2 0.7335
AT1G07090 LSH6 LIGHT SENSITIVE HYPOCOTYLS 6, ... Lus10022023 22.1 0.7639
AT2G31160 OBO1, LSH3 ORGAN BOUNDARY 1, LIGHT SENSIT... Lus10024901 22.2 0.7670
AT4G22720 Actin-like ATPase superfamily ... Lus10029108 22.8 0.7260
AT3G13677 unknown protein Lus10015813 27.3 0.7117
AT2G29380 HAI3 highly ABA-induced PP2C gene 3... Lus10003887 32.7 0.7221

Lus10037452 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.