Lus10037477 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42850 160 / 9e-52 Thioredoxin superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023026 258 / 1e-90 AT5G42850 161 / 4e-52 Thioredoxin superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G225500 222 / 3e-76 AT5G42850 171 / 4e-56 Thioredoxin superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF06110 DUF953 Eukaryotic protein of unknown function (DUF953)
Representative CDS sequence
>Lus10037477 pacid=23167181 polypeptide=Lus10037477 locus=Lus10037477.g ID=Lus10037477.BGIv1.0 annot-version=v1.0
ATGACTGTCAAAATTTTGGACGCGACGGTGGCGAGCTTCAACGAGGTGTTCGAGAAGTTCAAAGCAGAGTCGCCGAAATTCAAATCCAACCTCATCCTCT
TCCTCGCCGACAACGATCCGTCCACCAGTCTCAGCTGGTGCCCAGATTGCGTGAGGGCGGAGCCGGTGATACAGAAGAAGCTGGAAGCTTCCGGCGATGA
CGTGGCGCTCCTCCGAGCTTACGTTGGGGACAGACCCACTTGGAGGAACCCACACCACCCTTTGAGGGTGGATTCGAAGTTCAAGCTCACTGGTGTCCCG
ACTCTGATCCGCTGGGAGAATGATGCTGTTAAAGGAAAGCTTGAGGATCATGAAGCTCACCTTGAACGCAAAATCGATGGGCTTCTATCCACTACCGAGT
AA
AA sequence
>Lus10037477 pacid=23167181 polypeptide=Lus10037477 locus=Lus10037477.g ID=Lus10037477.BGIv1.0 annot-version=v1.0
MTVKILDATVASFNEVFEKFKAESPKFKSNLILFLADNDPSTSLSWCPDCVRAEPVIQKKLEASGDDVALLRAYVGDRPTWRNPHHPLRVDSKFKLTGVP
TLIRWENDAVKGKLEDHEAHLERKIDGLLSTTE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G42850 Thioredoxin superfamily protei... Lus10037477 0 1
AT4G13200 unknown protein Lus10022803 1.0 0.8768
AT3G48280 CYP71A25 "cytochrome P450, family 71, s... Lus10042419 4.7 0.8468
AT1G24625 C2H2ZnF ZFP7 zinc finger protein 7 (.1) Lus10010388 4.8 0.7756
AT5G67300 MYB ATMYB44, AtMYBr... ARABIDOPSIS THALIANA MYB DOMAI... Lus10019314 5.5 0.7639
AT5G17060 ATARFB1B ADP-ribosylation factor B1B (.... Lus10020392 6.5 0.8389
AT1G26550 FKBP-like peptidyl-prolyl cis-... Lus10015714 7.5 0.8188
AT4G39235 unknown protein Lus10004160 7.7 0.8247
AT5G52060 ATBAG1 BCL-2-associated athanogene 1 ... Lus10006328 8.2 0.7595
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Lus10023188 8.5 0.8308
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10016317 8.9 0.8044

Lus10037477 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.