Lus10037480 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06850 183 / 2e-53 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT3G57880 176 / 8e-51 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
AT1G51570 176 / 9e-51 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
AT5G48060 176 / 3e-50 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT4G11610 160 / 5e-45 NTRB, ATNTRB C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT5G12970 155 / 2e-43 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
AT1G22610 153 / 2e-42 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT4G00700 144 / 3e-39 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT3G61300 140 / 6e-38 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT1G04150 132 / 4e-35 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015709 278 / 3e-93 AT5G48060 371 / 2e-120 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10021030 189 / 3e-55 AT5G06850 1383 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10023823 188 / 6e-55 AT5G06850 1382 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10012026 184 / 1e-53 AT3G57880 1496 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Lus10016280 183 / 4e-53 AT3G57880 1499 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Lus10031816 176 / 2e-52 AT4G11610 513 / 1e-176 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10031244 176 / 8e-51 AT5G12970 979 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Lus10018839 156 / 3e-43 AT4G11610 1348 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10009460 152 / 2e-42 AT1G22610 627 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G271400 202 / 1e-59 AT5G48060 1481 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.009G065600 201 / 1e-59 AT5G06850 1308 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.006G058900 187 / 1e-54 AT3G57880 1372 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Potri.016G049100 185 / 8e-54 AT3G57880 1425 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Potri.T085601 179 / 1e-51 AT5G12970 1315 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Potri.003G210801 179 / 1e-51 AT5G12970 1300 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Potri.001G015700 178 / 1e-51 AT5G12970 1295 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Potri.006G058700 177 / 4e-51 AT5G06850 1321 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.016G049300 174 / 9e-50 AT5G06850 1355 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.002G158000 167 / 4e-47 AT4G11610 1400 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0154 C2 PF00168 C2 C2 domain
Representative CDS sequence
>Lus10037480 pacid=23167122 polypeptide=Lus10037480 locus=Lus10037480.g ID=Lus10037480.BGIv1.0 annot-version=v1.0
ATGCACCATCTTGCTGCTGCTGCTACTTCTGCTAACAGTGCAGCCTCAGGGCAGCACTACCGCGGCCGCAACAACGAAGATGATGATGATGATAACTACA
TCTTGAAGGACACCAATGTACATCGAGGGCAGAGGTTGTGGCAATCTGGAAGATCAGGATTCAGTTCGGCGTCCGCTACGACGAAATTCGACCTGGTGGA
GCAAATCTCGTACCTTTATGTCCGAGTAGTGAAAGCCAAAGACCTCCCTCCAGCTTCCTCCATCGCCAACACCTGCGATCCGTACGTCGAAATCAAACTC
GGCAACTACAAGGGAAGAACAAAGCATTTCGAGAAGAAATCAAATCCTGAATGGAACCAGGTATTCGCCTTCTCCAAGGACAGAATCCAATCCTCTGTTC
TTGAAGTCTACGTAAAGGACAGAGAGATCAAGGGAGACGATTACCTCGGCAGAGTCACCTTCGATTTGAACGAAATCCCCACCAGAGTCCCGCCGGACAG
TCCACTCGCAGCTCAGCGACAGCGCCCGCGCCGCCACCCCAGCGCCCCTGCCGGGCCCGCAGCGGCGGCCACGGCGAGATCATGCTGGTCGTTTGGATGG
GGACGCAAGCTGATGAAGCGTTTCCGGAAGCTTGGAACGCCGATTCCGCCGGAATCAGCGGAGGCGCCGCCGTCGGAGTTAGGTCAAAAGTCTATGTCTC
TCCCAAGCTGTGGTACGTCCGTGTGA
AA sequence
>Lus10037480 pacid=23167122 polypeptide=Lus10037480 locus=Lus10037480.g ID=Lus10037480.BGIv1.0 annot-version=v1.0
MHHLAAAATSANSAASGQHYRGRNNEDDDDDNYILKDTNVHRGQRLWQSGRSGFSSASATTKFDLVEQISYLYVRVVKAKDLPPASSIANTCDPYVEIKL
GNYKGRTKHFEKKSNPEWNQVFAFSKDRIQSSVLEVYVKDREIKGDDYLGRVTFDLNEIPTRVPPDSPLAAQRQRPRRHPSAPAGPAAAATARSCWSFGW
GRKLMKRFRKLGTPIPPESAEAPPSELGQKSMSLPSCGTSV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G06850 C2 calcium/lipid-binding plant... Lus10037480 0 1
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10034567 2.2 0.9208
AT1G06490 CalS7, ATGSL7, ... callose synthase 7, Arabidopsi... Lus10001056 4.6 0.8631
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10000548 5.1 0.8953
AT1G06490 CalS7, ATGSL7, ... callose synthase 7, Arabidopsi... Lus10001424 5.5 0.8494
AT3G22400 ATLOX5, LOX5 Arabidopsis thaliana lipoxygen... Lus10025857 8.1 0.8921
AT2G37050 Leucine-rich repeat protein ki... Lus10019907 9.2 0.8180
AT3G59100 ATGSL11 glucan synthase-like 11 (.1) Lus10020751 9.4 0.8613
AT5G36930 Disease resistance protein (TI... Lus10033953 10.0 0.8903
AT3G18670 Ankyrin repeat family protein ... Lus10027721 10.7 0.8879
AT3G14570 ATGSL4, ATGSL04 glucan synthase-like 4 (.1.2) Lus10042478 11.0 0.8360

Lus10037480 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.