Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15930 119 / 4e-36 Dynein light chain type 1 family protein (.1) AT4G27360 59 / 1e-12 Dynein light chain type 1 family protein (.1) AT1G52240 54 / 9e-11 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT3G16120 50 / 2e-09 Dynein light chain type 1 family protein (.1) AT5G20110 50 / 2e-08 Dynein light chain type 1 family protein (.1) AT1G23220 45 / 6e-07 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006500 [exp] 184 / 5e-62 AT4G15930 119 / 4e-36 Dynein light chain type 1 family protein (.1) Lus10022596 [exp] 59 / 2e-12 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 58 / 4e-12 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10038566 [exp] 57 / 1e-11 AT4G27360 157 / 5e-51 Dynein light chain type 1 family protein (.1) Lus10011443 [exp] 56 / 2e-11 AT1G52240 164 / 2e-54 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10035868 [exp] 54 / 6e-11 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10025794 [exp] 51 / 2e-09 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10034609 [exp] 48 / 4e-08 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10021793 [exp] 48 / 4e-08 AT1G23220 176 / 6e-58 Dynein light chain type 1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G219900 [exp] 135 / 2e-42 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 69 / 2e-16 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1) Potri.001G407900 [exp] 64 / 2e-14 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.004G034000 [exp] 62 / 5e-14 AT4G27360 143 / 6e-46 Dynein light chain type 1 family protein (.1) Potri.006G091800 [exp] 62 / 5e-14 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.003G108700 [exp] 56 / 8e-11 AT5G20110 116 / 4e-33 Dynein light chain type 1 family protein (.1) Potri.003G052800 [exp] 54 / 9e-11 AT1G52240 151 / 3e-49 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.001G124700 [exp] 52 / 2e-09 AT5G20110 116 / 3e-33 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 51 / 5e-09 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.015G067800 [exp] 51 / 8e-09 AT5G20110 142 / 3e-41 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [flax] [poplar] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Lus10037494 pacid=23167359 polypeptide=Lus10037494 locus=Lus10037494.g ID=Lus10037494.BGIv1.0 annot-version=v1.0 ATGAACAGTGCCGCCGACAACACGAAGCGCAGCATCTCCGGGAATCTGCCCCCGCAGCCCGTCTCCGATAACCGCAAACTCGTCCCCGTCTCCGCCCCCG CCGTCGGCAAGAAAATCGTCATCAAGAACGCCGACATGAAAGAAGACATGCAGAAAGAGGCTGTGGATATTGCTATCGCTGCGTTTGAGAAAGATAATGT GGAGAAGGATGTGGCGGAGTACATAAAGAAGGAGTTCGACCGGAGGCACGGACCTACCTGGCATTGCATCGTTGGCCGGAATTTCGGTAATCCAATCTGA
AA sequence Show only first row Show all	>Lus10037494 pacid=23167359 polypeptide=Lus10037494 locus=Lus10037494.g ID=Lus10037494.BGIv1.0 annot-version=v1.0 MNSAADNTKRSISGNLPPQPVSDNRKLVPVSAPAVGKKIVIKNADMKEDMQKEAVDIAIAAFEKDNVEKDVAEYIKKEFDRRHGPTWHCIVGRNFGNPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15930			Dynein light chain type 1 fami...		Lus10037494 [exp]	0	1
AT4G15930			Dynein light chain type 1 fami...		Lus10006500 [exp]	1.0	0.9119
AT4G37090			unknown protein		Lus10019656 [exp]	1.4	0.8805
AT4G16650			O-fucosyltransferase family pr...		Lus10004729 [exp]	2.2	0.8518
AT3G51850		CPK13	calcium-dependent protein kina...		Lus10002482 [exp]	3.5	0.8575
AT2G34510			Protein of unknown function, D...		Lus10038495 [exp]	4.6	0.8613
AT1G56000			FAD/NAD(P)-binding oxidoreduct...		Lus10039206 [exp]	5.7	0.8168
AT3G10430			F-box and associated interacti...		Lus10007847 [exp]	6.9	0.8010
AT4G23630		RTNLB1, BTI1	Reticulan like protein B1, VIR...		Lus10032313 [exp]	7.9	0.8378
AT3G51850		CPK13	calcium-dependent protein kina...		Lus10004807 [exp]	7.9	0.8266
AT5G17520		MEX1, RCP1	MALTOSE EXCESS 1, root cap 1 (...		Lus10020364 [exp]	8.2	0.7858

Compare expression of checked genes

Lus10037494 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.