Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15910 73 / 5e-18 ATDI21 drought-induced 21 (.1) AT1G02820 56 / 1e-11 Late embryogenesis abundant 3 (LEA3) family protein (.1) AT4G02380 55 / 5e-11 SAG21, ATLEA5 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) AT3G53770 47 / 8e-08 late embryogenesis abundant 3 (LEA3) family protein (.1), late embryogenesis abundant 3 (LEA3) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006508 [exp] 155 / 1e-50 AT4G15910 73 / 2e-18 drought-induced 21 (.1) Lus10027986 [exp] 52 / 5e-10 AT1G02820 78 / 3e-20 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10008170 [exp] 50 / 4e-09 AT4G02380 83 / 3e-22 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10008169 [exp] 45 / 2e-07 AT1G02820 66 / 6e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10027987 [exp] 45 / 2e-07 AT1G02820 67 / 5e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G012100 [exp] 64 / 1e-14 AT4G15910 83 / 6e-22 drought-induced 21 (.1) Potri.002G203500 [exp] 56 / 1e-11 AT4G02380 74 / 1e-18 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.014G127700 [exp] 53 / 3e-10 AT4G02380 79 / 1e-20 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03242 [flax] [poplar] LEA_3 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10037497 pacid=23166995 polypeptide=Lus10037497 locus=Lus10037497.g ID=Lus10037497.BGIv1.0 annot-version=v1.0 ATGGCTAGCTCCCTCACTACCTCTAAGCTTCTTCCAGGTTCAGTCTCTATTTTCCGCGTTCGTTGTTTTTCTTCGGAGAGTTTATTGGAGTCATACACGA ACAGGAGAGGTTATGCTGCGACGGCGGATCCGTTAGGTGCTGTTGTTGCTAGAGGAGGGCCGGCCGGCAAGGTGCTGAAGGACGAGAAATCGGCGGCGAA CAAGGGTTCAGAGTCTGCTTGGTCTCCCGACCCGATCACCGGGCACTATAGGCCCGGGAATTCTCCTGACGAGATCGACCCAGTGGAGCTCCGACAAATG TTGCTGAACAACAGAGTCAAATCCAATTAG
AA sequence Show only first row Show all	>Lus10037497 pacid=23166995 polypeptide=Lus10037497 locus=Lus10037497.g ID=Lus10037497.BGIv1.0 annot-version=v1.0 MASSLTTSKLLPGSVSIFRVRCFSSESLLESYTNRRGYAATADPLGAVVARGGPAGKVLKDEKSAANKGSESAWSPDPITGHYRPGNSPDEIDPVELRQM LLNNRVKSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15910		ATDI21	drought-induced 21 (.1)		Lus10037497 [exp]	0	1
AT1G69210			Uncharacterised protein family...		Lus10026674 [exp]	8.5	0.7357
AT2G30970		ASP1	aspartate aminotransferase 1 (...		Lus10000181 [exp]	8.9	0.7295
AT4G18425			Protein of unknown function (D...		Lus10015395 [exp]	14.4	0.6754
AT4G35380			SEC7-like guanine nucleotide e...		Lus10022975 [exp]	17.9	0.6904
AT5G54650		ATFH5, Fh5	FORMIN HOMOLOGY 5, formin homo...		Lus10015091 [exp]	18.5	0.7087
AT1G55900		TIM50, EMB1860	embryo defective 1860, Haloaci...		Lus10032582 [exp]	19.9	0.7061
AT3G16770	AP2_ERF	RAP2.03, ATEBP,...	RELATED TO AP2 3, ETHYLENE RES...		Lus10037487 [exp]	22.6	0.6835
AT4G34660			SH3 domain-containing protein ...		Lus10028785 [exp]	27.6	0.6336
AT1G01760			adenosine deaminases;RNA bindi...		Lus10017815 [exp]	27.9	0.6199
AT4G10265			Wound-responsive family protei...		Lus10033731 [exp]	32.7	0.7222

Compare expression of checked genes

Lus10037497 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.