Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05560 173 / 5e-57 Ribosomal L22e protein family (.1.2.3) AT5G27770 149 / 8e-48 Ribosomal L22e protein family (.1) AT1G02830 127 / 6e-39 Ribosomal L22e protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006509 [exp] 188 / 6e-63 AT3G05560 196 / 3e-66 Ribosomal L22e protein family (.1.2.3) Lus10026555 [exp] 113 / 1e-33 AT3G05560 118 / 3e-36 Ribosomal L22e protein family (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G015300 [exp] 184 / 3e-61 AT3G05560 172 / 1e-56 Ribosomal L22e protein family (.1.2.3) Potri.005G024400 [exp] 181 / 3e-60 AT3G05560 174 / 9e-58 Ribosomal L22e protein family (.1.2.3) Potri.014G128800 [exp] 179 / 1e-59 AT3G05560 173 / 2e-57 Ribosomal L22e protein family (.1.2.3) Potri.002G204100 [exp] 176 / 2e-58 AT3G05560 172 / 8e-57 Ribosomal L22e protein family (.1.2.3) Potri.010G012700 [exp] 172 / 1e-56 AT3G05560 170 / 8e-56 Ribosomal L22e protein family (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01776 [flax] [poplar] Ribosomal_L22e Ribosomal L22e protein family
Representative CDS sequence Show only first row Show all	>Lus10037498 pacid=23167028 polypeptide=Lus10037498 locus=Lus10037498.g ID=Lus10037498.BGIv1.0 annot-version=v1.0 ATGAGCCGAGGAGCAGCTGGAGGTGCCGCCGGCGCCAAGGGAAAGAAGAAGGGAGTGACCTTCACCATCGACTGCGGTAAGCCAGTTGAGGATAAGATCA TGGATATCGCATCACTCGAGAAGTTTCTCCAGGAGCGGATCAAGGTTGGCGGCAAGGCTGGAGCTCTCGGCGACTCCGTCACCATCACTCGTGAGAAGAA CAAGATCACCGTCACCTCTGACTCCAACTTCTCTAAGCGTTACCTCAAGTACTTGACGAAGAAGTACTTGAAGAAGCACAACGTCAGGGATTGGCTTCGC GTGATTGCGTCCAACAAGGACCGCTCTGTCTACGAGCTTAGATACTTCAACATTGCTGAAAATGAAGGCGAGGAGGAAGATTAA
AA sequence Show only first row Show all	>Lus10037498 pacid=23167028 polypeptide=Lus10037498 locus=Lus10037498.g ID=Lus10037498.BGIv1.0 annot-version=v1.0 MSRGAAGGAAGAKGKKKGVTFTIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDSVTITREKNKITVTSDSNFSKRYLKYLTKKYLKKHNVRDWLR VIASNKDRSVYELRYFNIAENEGEEED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05560			Ribosomal L22e protein family ...		Lus10037498 [exp]	0	1
AT3G05560			Ribosomal L22e protein family ...		Lus10006509 [exp]	1.4	0.9418
AT4G22380			Ribosomal protein L7Ae/L30e/S1...		Lus10017031 [exp]	3.5	0.8636
AT5G06360			Ribosomal protein S8e family p...		Lus10021274 [exp]	3.9	0.8596
AT5G10360		RPS6B, EMB3010	Ribosomal protein small subuni...		Lus10007376 [exp]	4.5	0.8665
AT4G34670			Ribosomal protein S3Ae (.1)		Lus10041191 [exp]	7.5	0.8596
AT3G13230			RNA-binding KH domain-containi...		Lus10027099 [exp]	9.4	0.7980
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Lus10016431 [exp]	9.5	0.8480
AT3G49010		RSU2, ATBBC1	40S RIBOSOMAL PROTEIN, breast ...		Lus10020398 [exp]	13.1	0.8383
AT3G44620			protein tyrosine phosphatases;...		Lus10019533 [exp]	13.3	0.8301
AT5G28060			Ribosomal protein S24e family ...		Lus10004123 [exp]	13.5	0.8443

Compare expression of checked genes

Lus10037498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.