Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24860 139 / 3e-44 ATFPF1, FPF1 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) AT5G10625 129 / 3e-40 unknown protein AT4G31380 128 / 6e-39 FLP1 FPF1-like protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000506 [exp] 218 / 3e-75 AT5G24860 142 / 2e-45 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) Lus10020156 [exp] 146 / 1e-46 AT5G24860 180 / 4e-60 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) Lus10026956 [exp] 141 / 7e-45 AT5G24860 174 / 5e-58 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) Lus10040802 [exp] 103 / 8e-30 AT4G31380 95 / 2e-25 FPF1-like protein 1 (.1) Lus10016534 [exp] 38 / 0.0002 ND 37 / 2e-07
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G209300 [exp] 184 / 5e-62 AT5G24860 140 / 1e-44 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) Potri.010G024500 [exp] 181 / 2e-60 AT5G24860 139 / 4e-44 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1) Potri.006G276100 [exp] 146 / 6e-47 AT5G10625 167 / 5e-55 unknown protein Potri.018G005200 [exp] 140 / 1e-44 AT5G10625 165 / 2e-54 unknown protein Potri.009G031600 [exp] 131 / 1e-40 AT5G24860 114 / 6e-34 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037510 pacid=23167113 polypeptide=Lus10037510 locus=Lus10037510.g ID=Lus10037510.BGIv1.0 annot-version=v1.0 ATGTCGGGGGTGTGGGTGTTCAAGAACGGCGTCGTGCGGCTGGTGGGGAATCCAGGGAGCGAGTCCTCGTCGATGGGGAGCAGGGCGAGGAAGGTGCTTG TACACGCGCCGACCAACGAGGTGATAACATCGTATGCCGTGCTAGAGAGGAAGCTGTCGGAGCTAGGGTGGGAGAGGTACTACGACGAACCGGATCTGCT ACAGTTCCACAAGAGATCGACGGTGCACCTCATCTCCCTCCCGAGGGACTTCTCAAGGTTCAAGTCCATGCACATGTACGACATCGTCGTCAAGAACCGC CACATGTTCGAAGTTCGCGACCACTAG
AA sequence Show only first row Show all	>Lus10037510 pacid=23167113 polypeptide=Lus10037510 locus=Lus10037510.g ID=Lus10037510.BGIv1.0 annot-version=v1.0 MSGVWVFKNGVVRLVGNPGSESSSMGSRARKVLVHAPTNEVITSYAVLERKLSELGWERYYDEPDLLQFHKRSTVHLISLPRDFSRFKSMHMYDIVVKNR HMFEVRDH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24860		ATFPF1, FPF1	ARABIDOPSIS FLOWERING PROMOTIN...		Lus10037510 [exp]	0	1
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10025413 [exp]	1.0	0.9167
AT2G37890			Mitochondrial substrate carrie...		Lus10016522 [exp]	3.5	0.8654
					Lus10041941 [exp]	3.7	0.8945
					Lus10015488 [exp]	7.5	0.8897
AT5G06540			Pentatricopeptide repeat (PPR)...		Lus10031424 [exp]	8.8	0.8505
AT3G45070			P-loop containing nucleoside t...		Lus10003068 [exp]	9.2	0.8505
AT2G44820			unknown protein		Lus10026825 [exp]	9.9	0.8444
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10002393 [exp]	10.5	0.8392
AT1G31860		HISN2, AT-IE	HISTIDINE BIOSYNTHESIS 2, hist...		Lus10043483 [exp]	11.0	0.8364
AT1G24430			HXXXD-type acyl-transferase fa...		Lus10006219 [exp]	13.9	0.7701

Compare expression of checked genes

Lus10037510 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.