Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15800 131 / 1e-40 RALFL33 ralf-like 33 (.1) AT1G02900 111 / 5e-33 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1) AT3G16570 111 / 1e-32 ATRALF23, RALFL23 ARABIDOPSIS RAPID ALKALINIZATION FACTOR 23, rapid alkalinization factor 23 (.1) AT3G05490 103 / 7e-30 RALFL22 ralf-like 22 (.1) AT2G33775 85 / 2e-22 RALFL19 ralf-like 19 (.1) AT4G13950 79 / 5e-20 RALFL31 ralf-like 31 (.1) AT1G28270 78 / 8e-20 RALFL4 ralf-like 4 (.1) AT3G23805 66 / 9e-15 RALFL24 ralf-like 24 (.1) AT4G14010 61 / 5e-13 RALFL32 ralf-like 32 (.1) AT5G67070 57 / 2e-11 RALFL34 ralf-like 34 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000502 [exp] 183 / 3e-61 AT4G15800 134 / 1e-41 ralf-like 33 (.1) Lus10029893 [exp] 104 / 4e-30 AT4G15800 116 / 8e-35 ralf-like 33 (.1) Lus10020647 [exp] 99 / 1e-27 AT4G15800 119 / 5e-36 ralf-like 33 (.1) Lus10015172 [exp] 94 / 8e-26 AT4G15800 107 / 2e-31 ralf-like 33 (.1) Lus10025444 [exp] 71 / 5e-17 AT1G28270 100 / 2e-28 ralf-like 4 (.1) Lus10015316 [exp] 70 / 2e-16 AT1G28270 100 / 7e-29 ralf-like 4 (.1) Lus10016646 [exp] 65 / 1e-14 AT4G13950 100 / 1e-28 ralf-like 31 (.1) Lus10005541 [exp] 64 / 3e-14 AT1G28270 69 / 3e-16 ralf-like 4 (.1) Lus10015431 [exp] 63 / 9e-14 AT1G28270 81 / 7e-21 ralf-like 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G208200 [exp] 152 / 4e-49 AT4G15800 132 / 2e-41 ralf-like 33 (.1) Potri.005G025800 [exp] 121 / 1e-36 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.013G017400 [exp] 117 / 5e-35 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.014G131800 [exp] 107 / 2e-31 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.004G044900 [exp] 90 / 1e-24 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.004G045000 [exp] 90 / 2e-24 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.017G059500 [exp] 77 / 5e-19 AT4G13950 96 / 2e-26 ralf-like 31 (.1) Potri.007G044700 [exp] 63 / 8e-14 AT5G67070 119 / 1e-35 ralf-like 34 (.1) Potri.001G320700 [exp] 62 / 2e-13 AT3G23805 96 / 1e-26 ralf-like 24 (.1) Potri.005G139100 [exp] 57 / 2e-11 AT5G67070 118 / 4e-35 ralf-like 34 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [flax] [poplar] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Lus10037512 pacid=23167040 polypeptide=Lus10037512 locus=Lus10037512.g ID=Lus10037512.BGIv1.0 annot-version=v1.0 ATGGGAAGAAGCCAGATGAGAGGATTCCTCCTAATTTGCGCAATCCTTTCGCTACATCTGGCCGTATCGACATCAACAGCCATCGATTTCCTCCCTGTTA AATCCGGCGGCGGAGGATGCAACGGATCCATCGCCGAGTGTATGATCGACGGCGAGGAGTTCGCCATGGAGTCGGAGAGCGCCAGGGGCATTTTAGCTTC GAGAAGGTACATAAGCTACGGAGCTCTGAGGAGGAACAGCGTGCCGTGCTCGAGGCGCGGCGCATCTTACTACAATTGCCGGGGCGGAGCCCGGGCCAAC CCCTACAGCCGCGGCTGCTCCCGCATAACTCGCTGCCGCTATTGA
AA sequence Show only first row Show all	>Lus10037512 pacid=23167040 polypeptide=Lus10037512 locus=Lus10037512.g ID=Lus10037512.BGIv1.0 annot-version=v1.0 MGRSQMRGFLLICAILSLHLAVSTSTAIDFLPVKSGGGGCNGSIAECMIDGEEFAMESESARGILASRRYISYGALRRNSVPCSRRGASYYNCRGGARAN PYSRGCSRITRCRY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15800		RALFL33	ralf-like 33 (.1)		Lus10037512 [exp]	0	1
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10020773 [exp]	5.0	0.8265
AT2G26640		KCS11	3-ketoacyl-CoA synthase 11 (.1...		Lus10019446 [exp]	15.3	0.7512
AT2G26640		KCS11	3-ketoacyl-CoA synthase 11 (.1...		Lus10019448 [exp]	19.4	0.7504
AT2G41410			Calcium-binding EF-hand family...		Lus10038970 [exp]	19.8	0.7737
AT3G55640			Mitochondrial substrate carrie...		Lus10040257 [exp]	30.3	0.7445
AT1G77120		ADH1, ATADH, AT...	ARABIDOPSIS THALIANA ALCOHOL D...		Lus10042787 [exp]	31.2	0.7246
AT1G20270			2-oxoglutarate (2OG) and Fe(II...		Lus10017249 [exp]	32.4	0.7545
AT3G05010			Protein of unknown function, t...		Lus10040523 [exp]	33.0	0.6592
					Lus10040955 [exp]	35.8	0.6918
AT1G28380		NSL1	necrotic spotted lesions 1, MA...		Lus10025453 [exp]	38.3	0.7207

Compare expression of checked genes

Lus10037512 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.