Lus10037536 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G79910 181 / 2e-53 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT4G32350 141 / 1e-36 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G52315 132 / 4e-35 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G35730 102 / 1e-23 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G25420 86 / 2e-18 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT1G34220 86 / 4e-18 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT4G29440 74 / 5e-14 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G14830 72 / 2e-13 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G19710 71 / 3e-13 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G13340 62 / 2e-10 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011455 447 / 4e-158 AT1G79910 233 / 1e-73 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10035885 246 / 4e-77 AT1G79910 235 / 1e-72 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10025779 231 / 5e-71 AT1G79910 199 / 8e-59 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10025932 235 / 3e-70 AT5G48840 440 / 2e-149 ARABIDOPSIS THALIANA PANTOTHENATE SYNTHETASE, homolog of bacterial PANC (.1)
Lus10034905 166 / 8e-46 AT4G32350 256 / 3e-75 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10023635 163 / 1e-44 AT4G32350 252 / 9e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10038167 140 / 1e-36 AT5G48840 447 / 7e-155 ARABIDOPSIS THALIANA PANTOTHENATE SYNTHETASE, homolog of bacterial PANC (.1)
Lus10006061 100 / 4e-23 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10028724 99 / 1e-22 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G181300 195 / 4e-57 AT1G79910 244 / 1e-75 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.003G054500 178 / 5e-51 AT1G79910 216 / 4e-65 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.018G079500 158 / 6e-43 AT4G32350 240 / 1e-69 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.003G054700 154 / 2e-42 AT1G79910 141 / 1e-37 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.003G054601 149 / 1e-40 AT1G79910 140 / 3e-37 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.007G059800 97 / 5e-22 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.013G117100 97 / 7e-22 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.008G121300 94 / 2e-21 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.019G087400 93 / 2e-20 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.006G149800 84 / 3e-17 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Lus10037536 pacid=23167288 polypeptide=Lus10037536 locus=Lus10037536.g ID=Lus10037536.BGIv1.0 annot-version=v1.0
ATGACGAAGGTGAGGCTGGATTCGTCGGCGAAGAAGAAGAAAGCTGTGGCTAAGTATCTGAGACGCGACATCGCTGACCTTCTCAGGAATGGCCTCGATT
CCAATGCTTACGGCAGGGCAAAGTTTTCTCATTCTGAGCAGGCTGAAGGGCTGATAGTGGAGCAGAACATGGTAGCTGCTTACAAGTTCATGGACGAATT
CTGCGACTGCATTTCCACCAATCTTGCTACCTTAGACAAACAGATGGAATGCCCCAAGGAATGCAGAGAAGCCATACAGAGTTTGATGTATGCAGCAGCA
AGGTTAGCTGAGTTCCCAGAACTCCGCGACCTTCGATCTGTGTTTGCACAGAGATACAGAGATTGTCTCGAATTGTTTCTTAACAAAGAGTTTGGTGAGC
TGCTGAATCCAAGGCCTGCCACAAAAGAGATGAAGCTTCAGCTACTTGTTGATGTTGCACAAGAATTCTCCATCAAATGGGATCCAGAACTTTTCGATCA
GAAGCTCTCGAAACCTGATATTACTCCTCATGGTGTAGCGAACCTGTCGAGAAGACGAAGCGAAGCAGGAGCAGAACCACCAGCTCCGGTTTACGTCAGA
GCCAGGAGTGAGTCCACAGCAACAAGGAGAGCCTCCATTAGTACTGCTTCTCCCGTTGCTTCAGATGCTAGTAAGCCTTCCAAGTTCATGCCTCCGCCAC
CGTATGTCCGAGCCAATCCTGAAGCCTTACAACAGAAGCCTCGATCCGTTCGACAACGGCAACAAGCAACAAAACTGGACGAGGAGGAAAGGAAGCTCGA
CGAGCTATTGATACAGCAGAGCACAAAGAAAACAACAGCTTACGAGAGGAGCGTTACACATGGAGCGTTACACATCCGGCCGGTACGAAGCCTCTTTCGT
GGCGGTCAAGGAACAGTGATCAGAGGCATGCTCAATCTCTATCGGAAGTGCCGTCAGGACATGTCCATCCGAACCTACCTGATTATGATTCATTGGCGGA
CCGGATCGCTTCGATCAAGGGGAAAAATTGGTGATCTGAGATTGGGGGAAGGCCTTTTTAGGGTTTTCTTGTTGCTTACAAAAAAACCTGTCAGGTTTTT
GGAGTCTTAG
AA sequence
>Lus10037536 pacid=23167288 polypeptide=Lus10037536 locus=Lus10037536.g ID=Lus10037536.BGIv1.0 annot-version=v1.0
MTKVRLDSSAKKKKAVAKYLRRDIADLLRNGLDSNAYGRAKFSHSEQAEGLIVEQNMVAAYKFMDEFCDCISTNLATLDKQMECPKECREAIQSLMYAAA
RLAEFPELRDLRSVFAQRYRDCLELFLNKEFGELLNPRPATKEMKLQLLVDVAQEFSIKWDPELFDQKLSKPDITPHGVANLSRRRSEAGAEPPAPVYVR
ARSESTATRRASISTASPVASDASKPSKFMPPPPYVRANPEALQQKPRSVRQRQQATKLDEEERKLDELLIQQSTKKTTAYERSVTHGALHIRPVRSLFR
GGQGTVIRGMLNLYRKCRQDMSIRTYLIMIHWRTGSLRSRGKIGDLRLGEGLFRVFLLLTKKPVRFLES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G79910 Regulator of Vps4 activity in ... Lus10037536 0 1
AT2G39650 Protein of unknown function (D... Lus10023412 5.7 0.8702
AT2G27450 CPA, ATNLP1, NL... nitrilase-like protein 1 (.1.2... Lus10020627 10.1 0.8503
AT2G19130 S-locus lectin protein kinase ... Lus10039762 12.1 0.8016
AT5G07610 F-box family protein (.1) Lus10041733 12.7 0.8513
AT5G53130 ATCNGC1, CNGC1 CYCLIC NUCLEOTIDE-GATED CHANNE... Lus10038815 16.0 0.8300
AT3G52105 unknown protein Lus10019704 20.2 0.8213
AT1G55190 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, ... Lus10008600 26.1 0.7851
AT4G05440 EDA35 embryo sac development arrest ... Lus10027955 44.5 0.8360
AT3G11820 PEN1, AT-SYR1, ... PENETRATION1, SYNTAXIN RELATED... Lus10016173 49.2 0.8068
AT1G14300 ARM repeat superfamily protein... Lus10036742 55.0 0.8072

Lus10037536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.