Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15270 49 / 1e-09 Translation machinery associated TMA7 (.1) AT3G16040 44 / 1e-07 Translation machinery associated TMA7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G181800 [exp] 42 / 9e-07 AT1G15270 53 / 4e-11 Translation machinery associated TMA7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09072 [flax] [poplar] TMA7 Translation machinery associated TMA7
Representative CDS sequence Show only first row Show all	>Lus10037543 pacid=23167106 polypeptide=Lus10037543 locus=Lus10037543.g ID=Lus10037543.BGIv1.0 annot-version=v1.0 ATGTCTTCTAAGCAAGGTGGAAAGGCTAAGCCTTTGAAGCAGCCCAAGTCCGACAAGAAGGAGTACGACGATGTTGACAAGGCCTTCCTTCAGAAGAAGA AGGAAGAGGAGAAGGCTCTTAAGGACCTGAAGGCCAAGGCGCAGAAGGGAGCAGTGGGAGGTGCTGGCCTCAAGAAGAGCGGCAAGAAGTGA
AA sequence Show only first row Show all	>Lus10037543 pacid=23167106 polypeptide=Lus10037543 locus=Lus10037543.g ID=Lus10037543.BGIv1.0 annot-version=v1.0 MSSKQGGKAKPLKQPKSDKKEYDDVDKAFLQKKKEEEKALKDLKAKAQKGAVGGAGLKKSGKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15270			Translation machinery associat...		Lus10037543 [exp]	0	1
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10002228 [exp]	1.0	0.9316
AT1G55340			Protein of unknown function (D...		Lus10010650 [exp]	1.4	0.9242
AT5G03460			unknown protein		Lus10014419 [exp]	3.0	0.9178
AT1G04290			Thioesterase superfamily prote...		Lus10004288 [exp]	3.5	0.8951
AT5G11970			Protein of unknown function (D...		Lus10021581 [exp]	4.2	0.9053
AT1G25682			Family of unknown function (DU...		Lus10041495 [exp]	4.7	0.8996
AT4G25670			unknown protein		Lus10039276 [exp]	4.9	0.9156
AT5G03460			unknown protein		Lus10023922 [exp]	5.3	0.9037
AT3G45020			Ribosomal L18p/L5e family prot...		Lus10021433 [exp]	5.5	0.9001
AT5G63030		GRXC1	glutaredoxin C1, Thioredoxin s...		Lus10001237 [exp]	6.7	0.9069

Compare expression of checked genes

Lus10037543 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.