Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52300 159 / 2e-52 Zinc-binding ribosomal protein family protein (.1) AT1G15250 158 / 3e-52 Zinc-binding ribosomal protein family protein (.1) AT3G16080 156 / 2e-51 Zinc-binding ribosomal protein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011446 [exp] 190 / 1e-64 AT3G16080 162 / 1e-53 Zinc-binding ribosomal protein family protein (.1) Lus10035878 [exp] 188 / 1e-62 AT3G16080 166 / 1e-53 Zinc-binding ribosomal protein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G036900 [exp] 177 / 8e-60 AT1G15250 167 / 1e-55 Zinc-binding ribosomal protein family protein (.1) Potri.003G053100 [exp] 172 / 1e-57 AT3G16080 172 / 8e-58 Zinc-binding ribosomal protein family protein (.1) Potri.001G183200 [exp] 170 / 8e-57 AT3G16080 172 / 8e-58 Zinc-binding ribosomal protein family protein (.1) Potri.006G243300 [exp] 170 / 9e-57 AT1G15250 170 / 1e-56 Zinc-binding ribosomal protein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF01907 [flax] [poplar] Ribosomal_L37e Ribosomal protein L37e
Representative CDS sequence Show only first row Show all	>Lus10037549 pacid=23167189 polypeptide=Lus10037549 locus=Lus10037549.g ID=Lus10037549.BGIv1.0 annot-version=v1.0 ATGGGTAAGGGTACAGCGAGTTTCGGTAAGAGGAGGAACAAGACCCATACTCTCTGTGTGAGGTGCGGCCGCCGCAGTTTTCATCTCCAGAAGAGTCGCT GCTCCGCTTGTGCTTACCCTGCCGCTCGCGTCAGGAAATACAACTGGAGTGAGAAGGCTATTCGCCGAAAGACAACCGGAACTGGACGAATGAGGTACAT GCGACATATGGCTCGCAGGTTCAAGAGTGGATTCAGAGAGGGTACTCAAGCTGCGCCAAGGACCAAGGGAACTGCTGCAGCATCATCTTAA
AA sequence Show only first row Show all	>Lus10037549 pacid=23167189 polypeptide=Lus10037549 locus=Lus10037549.g ID=Lus10037549.BGIv1.0 annot-version=v1.0 MGKGTASFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARVRKYNWSEKAIRRKTTGTGRMRYMRHMARRFKSGFREGTQAAPRTKGTAAASS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G16080			Zinc-binding ribosomal protein...		Lus10037549 [exp]	0	1
AT4G16720			Ribosomal protein L23/L15e fam...		Lus10007805 [exp]	2.4	0.9750
AT5G15200			Ribosomal protein S4 (.1.2)		Lus10008624 [exp]	3.7	0.9739
AT5G35530			Ribosomal protein S3 family pr...		Lus10030503 [exp]	5.5	0.9681
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10023454 [exp]	5.7	0.9674
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10023457 [exp]	5.7	0.9590
AT2G42740		RPL16A	ribosomal protein large subuni...		Lus10017648 [exp]	5.9	0.9661
AT5G09510			Ribosomal protein S19 family p...		Lus10033856 [exp]	6.5	0.9644
AT4G39200			Ribosomal protein S25 family p...		Lus10040436 [exp]	8.7	0.9528
AT2G44120			Ribosomal protein L30/L7 famil...		Lus10004220 [exp]	8.8	0.9648
AT2G20450			Ribosomal protein L14 (.1)		Lus10011807 [exp]	10.0	0.9594

Compare expression of checked genes

Lus10037549 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.