Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52240 157 / 2e-51 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT3G16120 137 / 2e-43 Dynein light chain type 1 family protein (.1) AT4G27360 97 / 2e-27 Dynein light chain type 1 family protein (.1) AT4G15930 69 / 2e-16 Dynein light chain type 1 family protein (.1) AT5G20110 67 / 1e-14 Dynein light chain type 1 family protein (.1) AT1G23220 61 / 5e-13 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011443 [exp] 180 / 1e-60 AT1G52240 164 / 2e-54 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10035868 [exp] 159 / 5e-52 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10025794 [exp] 158 / 6e-52 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 106 / 6e-31 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 105 / 1e-30 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10038566 [exp] 89 / 5e-24 AT4G27360 157 / 5e-51 Dynein light chain type 1 family protein (.1) Lus10014484 [exp] 68 / 6e-15 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1) Lus10030069 [exp] 67 / 8e-15 AT5G20110 201 / 2e-65 Dynein light chain type 1 family protein (.1) Lus10034609 [exp] 65 / 1e-14 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G052800 [exp] 158 / 5e-52 AT1G52240 151 / 3e-49 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.006G091800 [exp] 108 / 8e-32 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.001G407900 [exp] 94 / 3e-26 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 91 / 5e-25 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1) Potri.004G034000 [exp] 88 / 5e-24 AT4G27360 143 / 6e-46 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 68 / 1e-15 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.008G219900 [exp] 67 / 1e-15 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1) Potri.010G108700 [exp] 67 / 2e-15 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 67 / 3e-15 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.003G108700 [exp] 66 / 7e-15 AT5G20110 116 / 4e-33 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [flax] [poplar] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Lus10037551 pacid=23167257 polypeptide=Lus10037551 locus=Lus10037551.g ID=Lus10037551.BGIv1.0 annot-version=v1.0 ATGTTGGAAGGGAAAGCAGTAGTTGATGATGCAGACATGCCAGAAAAATTGCAGGAACAAGCCATGGCTTCTGCATATGAAGCTCTGGATCTCTATGATG TCAGTGACTGCTTATCCATTGCTGGCCACATCAAGAAGAGGATTAGGGTCAATCCAGTAGCTTGTTATAGTTTCGGGGAGTTTGATGTGAGATATGGAAG TGGATGGCAATGTGTGGTGGGCTCAAACTTCGGATGCTTCTTCACTCACTCAAAAGGCACTTTCGTTTACTTCACATTGGAGACTCTCAAGTTCCTCATC TTCAAAGGAGCTTCTTCACCCTGA
AA sequence Show only first row Show all	>Lus10037551 pacid=23167257 polypeptide=Lus10037551 locus=Lus10037551.g ID=Lus10037551.BGIv1.0 annot-version=v1.0 MLEGKAVVDDADMPEKLQEQAMASAYEALDLYDVSDCLSIAGHIKKRIRVNPVACYSFGEFDVRYGSGWQCVVGSNFGCFFTHSKGTFVYFTLETLKFLI FKGASSP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Lus10037551 [exp]	0	1
AT3G29270			RING/U-box superfamily protein...		Lus10003473 [exp]	1.4	0.8766
AT5G67390			unknown protein		Lus10011080 [exp]	2.8	0.8664
AT5G55760		SRT1	sirtuin 1 (.1)		Lus10016619 [exp]	4.6	0.8686
					Lus10018814 [exp]	6.3	0.8437
AT5G07670			RNI-like superfamily protein (...		Lus10027217 [exp]	9.0	0.8435
AT3G47160			RING/U-box superfamily protein...		Lus10001209 [exp]	9.3	0.8771
AT1G72050	C2H2ZnF	TFIIIA	transcription factor IIIA (.1....		Lus10037673 [exp]	13.7	0.8401
AT5G62360			Plant invertase/pectin methyle...		Lus10027199 [exp]	14.1	0.8027
AT5G06340		ATNUDX27	nudix hydrolase homolog 27 (.1...		Lus10021279 [exp]	14.5	0.8292
AT3G01470	HD	HD-ZIP-1, HAT5,...	HOMEODOMAIN PROTEIN FROM ARABI...		Lus10025232 [exp]	15.7	0.8236

Compare expression of checked genes

Lus10037551 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.