Lus10037591 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G19770 201 / 9e-68 PRF5 profilin 5 (.1)
AT4G29340 197 / 3e-66 PRF4 profilin 4 (.1)
AT2G19760 188 / 6e-63 PRF1, PFN1 profilin 1 (.1)
AT4G29350 184 / 3e-61 PRF2, PFN2, PRO2 profilin 2 (.1)
AT5G56600 184 / 8e-61 PRF3, PFN3 profilin 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006846 239 / 5e-83 AT2G19770 229 / 5e-79 profilin 5 (.1)
Lus10011138 208 / 1e-70 AT2G19760 225 / 2e-77 profilin 1 (.1)
Lus10043040 207 / 4e-70 AT5G56600 223 / 1e-76 profilin 3 (.1.2)
Lus10012936 205 / 1e-69 AT4G29350 223 / 2e-76 profilin 2 (.1)
Lus10034988 202 / 2e-68 AT4G29340 219 / 3e-75 profilin 4 (.1)
Lus10043041 201 / 1e-67 AT4G29340 239 / 9e-83 profilin 4 (.1)
Lus10034989 198 / 9e-67 AT4G29340 234 / 6e-81 profilin 4 (.1)
Lus10011139 196 / 1e-65 AT4G29340 238 / 1e-82 profilin 4 (.1)
Lus10012935 193 / 7e-65 AT4G29340 235 / 2e-81 profilin 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G047700 213 / 8e-73 AT4G29340 224 / 5e-77 profilin 4 (.1)
Potri.001G190800 212 / 2e-72 AT2G19760 196 / 8e-66 profilin 1 (.1)
Potri.006G235200 202 / 2e-68 AT4G29340 216 / 1e-73 profilin 4 (.1)
Potri.018G057600 198 / 8e-67 AT4G29340 188 / 5e-63 profilin 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF00235 Profilin Profilin
Representative CDS sequence
>Lus10037591 pacid=23167337 polypeptide=Lus10037591 locus=Lus10037591.g ID=Lus10037591.BGIv1.0 annot-version=v1.0
ATGTCGTGGCAAACTTACGTCGACGAGCACCTGATGTGCGACATTGAAGGCAACCACCTCGCCTCCGCCGCTATCATCGGCCACGACGGCAGCGTCTGGG
CTCAGAGCGCCAACTTCCCTCAGTGTAAACCAGAGGAGATAACTGCAATGATGAAGGATTTTGACGAGCCTGGGACTCTTGCCCCAACCGGATTGCACCT
CGCTGGAGCAAAGTATATGGTGATCCAAGGAGAGGCAGGAGCTGTGATTCGTGGAAAGAAGGGTGCGGGAGGCGTGACAGTGAAGAAAACAGGACAAGCC
CTAGTGTTCGGTCTTTACGAAGAACCAGTAACTCCGGGACAATGCAACATGGTTGTTGAGAGGTTGGGTGATTACCTTGTTGATCAAGGCCTCTAA
AA sequence
>Lus10037591 pacid=23167337 polypeptide=Lus10037591 locus=Lus10037591.g ID=Lus10037591.BGIv1.0 annot-version=v1.0
MSWQTYVDEHLMCDIEGNHLASAAIIGHDGSVWAQSANFPQCKPEEITAMMKDFDEPGTLAPTGLHLAGAKYMVIQGEAGAVIRGKKGAGGVTVKKTGQA
LVFGLYEEPVTPGQCNMVVERLGDYLVDQGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G19770 PRF5 profilin 5 (.1) Lus10037591 0 1
AT5G48060 C2 calcium/lipid-binding plant... Lus10015710 1.4 0.8742
AT1G52190 Major facilitator superfamily ... Lus10025802 2.2 0.8901
AT2G19770 PRF5 profilin 5 (.1) Lus10006846 5.1 0.8471
AT1G52190 Major facilitator superfamily ... Lus10035860 7.4 0.8491
AT1G64620 DOF AtDof1,8 Dof-type zinc finger DNA-bindi... Lus10023032 7.5 0.8532
Lus10040408 7.9 0.8090
AT3G47570 Leucine-rich repeat protein ki... Lus10030630 9.5 0.8741
AT1G29390 COR413IM2, COR3... COLD REGULATED 314 INNER MEMBR... Lus10015258 10.2 0.8701
AT3G21310 Core-2/I-branching beta-1,6-N-... Lus10009738 11.0 0.8487
AT2G17550 unknown protein Lus10035987 11.7 0.8286

Lus10037591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.