Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33270 390 / 2e-136 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT4G33260 374 / 3e-130 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT5G27570 333 / 7e-115 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1) AT5G27945 333 / 1e-114 Transducin/WD40 repeat-like superfamily protein (.1) AT5G26900 325 / 5e-111 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1) AT5G27080 320 / 6e-109 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT5G13840 216 / 4e-68 FZR3 FIZZY-related 3 (.1.2) AT4G11920 213 / 4e-67 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1) AT4G22910 210 / 1e-65 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) AT5G08390 63 / 2e-11 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037593 [exp] 434 / 4e-154 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006851 [exp] 423 / 1e-149 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006853 [exp] 429 / 1e-146 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10034687 [exp] 345 / 1e-118 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042765 [exp] 321 / 4e-110 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042748 [exp] 312 / 3e-101 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10025838 [exp] 292 / 4e-101 AT4G33270 295 / 3e-99 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10011833 [exp] 264 / 9e-90 AT4G33270 255 / 4e-83 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10043009 [exp] 211 / 2e-66 AT4G33270 344 / 1e-114 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G118400 [exp] 390 / 2e-136 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.019G021800 [exp] 376 / 4e-131 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.013G048900 [exp] 375 / 8e-131 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 324 / 1e-110 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.015G110300 [exp] 211 / 2e-66 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.001G112700 [exp] 211 / 3e-66 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.003G119500 [exp] 209 / 2e-65 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.008G057500 [exp] 207 / 2e-64 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2) Potri.010G202100 [exp] 204 / 2e-63 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2) Potri.008G002300 [exp] 64 / 6e-12 AT5G08390 1006 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10037595 pacid=23167357 polypeptide=Lus10037595 locus=Lus10037595.g ID=Lus10037595.BGIv1.0 annot-version=v1.0 ATGGATGGAAGGATTATAAACAACGATGTCCGAATCAGAAGACACATAGTTGAAACATACAGAGGCCACACGCAAGAAGTCTGTGGACTGAAATGGTCAG CTTCAGGTCAACAACTAGCAAGCGGAGGAAACGACAATCGCGTCCACATATGGGACAGATCCATGGCTTCTTCCAACTCAGCAACTCAGTATCTTCACCG ACTCGAAGATCATCCCTCGGCGGTAAAGGCTCTAGCTTGGTGTCCGTTCCAAGGGAACTTGCTAGCCACAGGTGGTGGTGGAGGAGACAGAACTATCAAG TTCTGGAACACTCATACTGGCGCGTGCTTGAACTCGGTGGACACTGGATCCCAGGTGTGTGCATTGCTGTGGAACAAGAATGAGAGGGAGCTTCTGAGCT CTCATGGGTTTACGCAGAATCAGCTTACCTTGTGGAAGTATCCGTCCATGGTGAAGACTGCTGAGCTTACTGGCCACACCTCGAGGGTTTTGTTCATGGC TCAGAGTCCTGATGGGTGCACTGTGGCGTCAGCGGCAGGGGATGAAACTCTGAGGTTCTGGAACGTGTTTGGGGATCCTGAAGCTGCCAAGAAATCTGCT CCGAAAGCCAATCCCGAGCCGTTCGCTTGGGCCAATCGAATCCGGTGA
AA sequence Show only first row Show all	>Lus10037595 pacid=23167357 polypeptide=Lus10037595 locus=Lus10037595.g ID=Lus10037595.BGIv1.0 annot-version=v1.0 MDGRIINNDVRIRRHIVETYRGHTQEVCGLKWSASGQQLASGGNDNRVHIWDRSMASSNSATQYLHRLEDHPSAVKALAWCPFQGNLLATGGGGGDRTIK FWNTHTGACLNSVDTGSQVCALLWNKNERELLSSHGFTQNQLTLWKYPSMVKTAELTGHTSRVLFMAQSPDGCTVASAAGDETLRFWNVFGDPEAAKKSA PKANPEPFAWANRIR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10037595 [exp]	0	1
AT2G20590			Reticulon family protein (.1.2...		Lus10002173 [exp]	1.7	0.9593
AT2G20590			Reticulon family protein (.1.2...		Lus10039890 [exp]	5.8	0.9494
AT5G13840		FZR3	FIZZY-related 3 (.1.2)		Lus10023401 [exp]	11.1	0.9391
AT2G22610			Di-glucose binding protein wit...		Lus10025708 [exp]	14.3	0.9402
AT3G15550			unknown protein		Lus10025758 [exp]	14.3	0.9374
AT1G18370		HIK, ATNACK1	HINKEL, ARABIDOPSIS NPK1-ACTIV...		Lus10032452 [exp]	17.7	0.9380
AT3G21620			ERD (early-responsive to dehyd...		Lus10035300 [exp]	21.2	0.9278
					Lus10001684 [exp]	21.7	0.9291
AT1G65710			unknown protein		Lus10031373 [exp]	22.5	0.9203
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10006853 [exp]	23.5	0.8987

Compare expression of checked genes

Lus10037595 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.