Lus10037596 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17420 241 / 2e-80 NTR2, ATNTRA, NTRA NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
AT4G35460 236 / 1e-78 ATNTRB, TRB1, NTR1 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 1, NADPH-dependent thioredoxin reductase B (.1)
AT2G41680 139 / 7e-40 NTRC NADPH-dependent thioredoxin reductase C (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006853 285 / 2e-92 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Lus10038256 256 / 7e-88 AT2G17420 442 / 1e-157 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
Lus10025845 255 / 5e-87 AT2G17420 437 / 7e-155 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
Lus10018051 129 / 3e-36 AT2G41680 845 / 0.0 NADPH-dependent thioredoxin reductase C (.1)
Lus10042048 129 / 8e-36 AT2G41680 840 / 0.0 NADPH-dependent thioredoxin reductase C (.1)
Lus10019550 99 / 2e-27 AT2G17420 202 / 5e-65 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G456800 254 / 2e-85 AT2G17420 582 / 0.0 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
Potri.011G145100 251 / 1e-84 AT2G17420 568 / 0.0 NADPH-DEPENDENT THIOREDOXIN REDUCTASE 2, NADPH-dependent thioredoxin reductase A (.1)
Potri.006G049100 130 / 1e-36 AT2G41680 785 / 0.0 NADPH-dependent thioredoxin reductase C (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Representative CDS sequence
>Lus10037596 pacid=23167094 polypeptide=Lus10037596 locus=Lus10037596.g ID=Lus10037596.BGIv1.0 annot-version=v1.0
ATGGAGGAGGCGAATTTCTTGACGAAGTACGGGAGCAAGGTTTACATCATTCATCGGAGGGACACCTTTAGGGCATCGAAGATTATGCAGAACAGGGCGA
TGAAGAACCCTAAGATTGAGGTGATTTGGAATTCGGTAACGGAGGAGGCCTATGGTGAGAAGTCGCTAAAAGGATTGAAGGTGAAGAACATTGTTAGCGG
TGAGGTTTCTGATTTGACAGTTTCCGGGTTGTTCTTCGCCATTGGACATGAGCCTGCTACTAAGTTCTTGGATGGGCAGCTTGAGGTTCACTCTGATGGA
TACGTTGTGACGAAGCCTGGAACTACGCAGACTAGTGTTAGAGGTGTTTTTGCTGCTGGTGATGTTCAGGATAAGAAGTATAGGCAGGCCATTACTGCTG
CTGGCACTGGTTAG
AA sequence
>Lus10037596 pacid=23167094 polypeptide=Lus10037596 locus=Lus10037596.g ID=Lus10037596.BGIv1.0 annot-version=v1.0
MEEANFLTKYGSKVYIIHRRDTFRASKIMQNRAMKNPKIEVIWNSVTEEAYGEKSLKGLKVKNIVSGEVSDLTVSGLFFAIGHEPATKFLDGQLEVHSDG
YVVTKPGTTQTSVRGVFAAGDVQDKKYRQAITAAGTG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G17420 NTR2, ATNTRA, N... NADPH-DEPENDENT THIOREDOXIN RE... Lus10037596 0 1
AT1G18480 AtSLP2 Shewenella-like protein phosph... Lus10014985 1.0 0.8787
AT4G02340 alpha/beta-Hydrolases superfam... Lus10009859 2.8 0.8617
AT5G04410 NAC NAC2, ANAC078 Arabidopsis NAC domain contain... Lus10028824 2.8 0.8521
AT5G22250 AtCAF1b CCR4- associated factor 1b, Po... Lus10021304 3.5 0.8336
AT3G05500 Rubber elongation factor prote... Lus10015171 3.9 0.8486
AT1G07310 Calcium-dependent lipid-bindin... Lus10005867 4.2 0.8597
AT5G03370 acylphosphatase family (.1) Lus10026533 4.2 0.8467
AT3G62580 Late embryogenesis abundant pr... Lus10025037 8.0 0.8317
AT1G34370 C2H2ZnF STOP1 sensitive to proton rhizotoxic... Lus10006071 8.5 0.8182
AT1G19140 unknown protein Lus10027662 8.8 0.7971

Lus10037596 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.