Lus10037609 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G19730 221 / 2e-75 Ribosomal L28e protein family (.1.2.3)
AT4G29410 218 / 3e-74 Ribosomal L28e protein family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006869 301 / 1e-106 AT2G19730 218 / 3e-74 Ribosomal L28e protein family (.1.2.3)
Lus10012914 225 / 5e-77 AT4G29410 224 / 7e-77 Ribosomal L28e protein family (.1.2)
Lus10012915 224 / 1e-76 AT4G29410 224 / 1e-76 Ribosomal L28e protein family (.1.2)
Lus10032699 217 / 9e-74 AT4G29410 219 / 1e-74 Ribosomal L28e protein family (.1.2)
Lus10032698 107 / 8e-30 ND 134 / 1e-40
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G045500 237 / 9e-82 AT2G19730 230 / 3e-79 Ribosomal L28e protein family (.1.2.3)
Potri.001G194000 222 / 1e-75 AT2G19730 227 / 1e-77 Ribosomal L28e protein family (.1.2.3)
Potri.006G212501 42 / 9e-06 AT4G29410 45 / 2e-07 Ribosomal L28e protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01778 Ribosomal_L28e Ribosomal L28e protein family
Representative CDS sequence
>Lus10037609 pacid=23167346 polypeptide=Lus10037609 locus=Lus10037609.g ID=Lus10037609.BGIv1.0 annot-version=v1.0
ATGGCGACAGTATCTGAGCAGCTCATTTGGGAGGTTGTGAAGAGGAACAATTCGTTTCTCGTAAAGCAGTTCGGGAGAGGAACTTCTGGCATCGTCTTCA
GCAAAGAGAGCAACAATCTGTACAATCTCAACTCGTACAAGCACTCCGGGTTGGCAAATAAGAAGACGGTGACGATTCAGCCAGCAGAAAAGGAACAAGC
TGTGGTACTTGCTACAACCAAGACGAAGAAGCAGAACAAACCATCTGCATTGGTTCACAAGTCTGTCCTGAAGAAGGAGTTCTATCGCATGGCTAAGGCC
GTGTTGAACCAGGTGGGCGATAACTTCTACAGGCCGGACCTGAAGAAAGCTGCACTTGCAAGGCTGAGTGCTGTGAACAGAGGCCTCAAGGTTTCAAAGT
CTGGAATCAAGAAGAGGACCAGACAAGCCACCAAGATCCATGGGAGGAAGTGA
AA sequence
>Lus10037609 pacid=23167346 polypeptide=Lus10037609 locus=Lus10037609.g ID=Lus10037609.BGIv1.0 annot-version=v1.0
MATVSEQLIWEVVKRNNSFLVKQFGRGTSGIVFSKESNNLYNLNSYKHSGLANKKTVTIQPAEKEQAVVLATTKTKKQNKPSALVHKSVLKKEFYRMAKA
VLNQVGDNFYRPDLKKAALARLSAVNRGLKVSKSGIKKRTRQATKIHGRK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G19730 Ribosomal L28e protein family ... Lus10037609 0 1
AT3G10950 Zinc-binding ribosomal protein... Lus10006414 1.0 0.9174
AT2G19730 Ribosomal L28e protein family ... Lus10006869 2.0 0.9028
AT3G52570 alpha/beta-Hydrolases superfam... Lus10016992 2.4 0.9116
AT3G12390 Nascent polypeptide-associated... Lus10041610 2.8 0.8878
AT4G09800 RPS18C S18 ribosomal protein (.1) Lus10006914 3.5 0.9060
AT5G02610 Ribosomal L29 family protein ... Lus10025292 3.9 0.9010
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10010993 6.2 0.8485
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Lus10041029 6.5 0.9000
AT4G38370 Phosphoglycerate mutase family... Lus10014434 6.6 0.8008
AT4G34670 Ribosomal protein S3Ae (.1) Lus10006609 8.8 0.8974

Lus10037609 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.