Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67120 65 / 6e-14 ATPases;nucleotide binding;ATP binding;nucleoside-triphosphatases;transcription factor binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006875 [exp] 127 / 5e-36 AT1G67120 640 / 0.0 ATPases;nucleotide binding;ATP binding;nucleoside-triphosphatases;transcription factor binding (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G039100 [exp] 72 / 2e-16 AT1G67120 4856 / 0.0 ATPases;nucleotide binding;ATP binding;nucleoside-triphosphatases;transcription factor binding (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037615 pacid=23167353 polypeptide=Lus10037615 locus=Lus10037615.g ID=Lus10037615.BGIv1.0 annot-version=v1.0 ATGGTGGCCTTCCTGCTACTGGACAATCCTGAAGATCATGTGGCAAAGCAGGAGAAAGCGTTGTTTGAGGACGGAAAGTTACTGAAGGAGTTGTATATGG ATTCGTTCCCGTCTCGGTACCACATCGTGTTGAAAGATATCGAAGCGCTTCTGAGGATGCTGGCGGATGTGCTAAGGCAGTGGTTGGAGATTATGCAGTC CTTCAAGGAGTAG
AA sequence Show only first row Show all	>Lus10037615 pacid=23167353 polypeptide=Lus10037615 locus=Lus10037615.g ID=Lus10037615.BGIv1.0 annot-version=v1.0 MVAFLLLDNPEDHVAKQEKALFEDGKLLKELYMDSFPSRYHIVLKDIEALLRMLADVLRQWLEIMQSFKE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67120			ATPases;nucleotide binding;ATP...		Lus10037615 [exp]	0	1
					Lus10043057 [exp]	1.0	0.8991
AT4G21760		BGLU47	beta-glucosidase 47 (.1)		Lus10032659 [exp]	1.7	0.8804
AT5G37590			Tetratricopeptide repeat (TPR)...		Lus10004034 [exp]	2.0	0.8753
AT5G10250		DOT3	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10026046 [exp]	3.5	0.8859
AT4G21510			F-box family protein (.1)		Lus10022370 [exp]	3.9	0.8713
AT1G25260			Ribosomal protein L10 family p...		Lus10001072 [exp]	4.9	0.8690
AT1G18010			Major facilitator superfamily ...		Lus10043370 [exp]	5.9	0.8650
AT5G57910			unknown protein		Lus10036255 [exp]	7.7	0.8489
AT1G55310		ATSCL33, SR33, ...	SC35-like splicing factor 33 (...		Lus10017299 [exp]	7.7	0.8220
AT1G30690			Sec14p-like phosphatidylinosit...		Lus10031176 [exp]	9.4	0.8628

Compare expression of checked genes

Lus10037615 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.