Lus10037619 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G49610 48 / 4e-07 F-box family protein (.1)
AT3G57590 44 / 2e-05 F-box and associated interaction domains-containing protein (.1)
AT3G57580 42 / 5e-05 F-box and associated interaction domains-containing protein (.1)
AT1G33020 41 / 0.0002 F-box and associated interaction domains-containing protein (.1)
AT3G17530 40 / 0.0002 F-box and associated interaction domains-containing protein (.1)
AT5G15660 40 / 0.0002 F-box and associated interaction domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028682 96 / 1e-23 AT5G49610 62 / 2e-10 F-box family protein (.1)
Lus10000860 94 / 3e-23 AT5G49610 52 / 3e-07 F-box family protein (.1)
Lus10003922 74 / 6e-16 AT3G26010 60 / 1e-09 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10037467 74 / 8e-16 AT3G26010 61 / 1e-09 Galactose oxidase/kelch repeat superfamily protein (.1)
Lus10036954 70 / 2e-14 ND 48 / 5e-06
Lus10036951 62 / 2e-12 ND 44 / 2e-05
Lus10000664 49 / 2e-07 AT3G23570 166 / 1e-48 alpha/beta-Hydrolases superfamily protein (.1)
Lus10008162 47 / 7e-07 AT1G60370 48 / 5e-07 F-box and associated interaction domains-containing protein (.1)
Lus10040838 46 / 3e-06 AT3G23950 57 / 2e-08 F-box family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G149000 47 / 7e-07 AT5G49610 528 / 0.0 F-box family protein (.1)
Potri.011G121200 47 / 7e-07 AT4G12560 116 / 9e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.011G004800 44 / 1e-05 AT5G49610 65 / 3e-11 F-box family protein (.1)
Potri.001G224200 42 / 6e-05 AT3G07870 105 / 4e-25 F-box and associated interaction domains-containing protein (.1)
Potri.011G137200 40 / 0.0002 AT3G07870 94 / 1e-20 F-box and associated interaction domains-containing protein (.1)
Potri.011G037312 40 / 0.0003 AT3G07870 134 / 3e-35 F-box and associated interaction domains-containing protein (.1)
Potri.001G318400 40 / 0.0003 AT3G06240 142 / 3e-38 F-box family protein (.1)
Potri.009G132400 39 / 0.0004 ND /
Potri.004G112400 39 / 0.0005 AT5G15710 753 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Potri.011G037200 39 / 0.0007 AT3G07870 134 / 6e-35 F-box and associated interaction domains-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10037619 pacid=23167077 polypeptide=Lus10037619 locus=Lus10037619.g ID=Lus10037619.BGIv1.0 annot-version=v1.0
ATGGAAATCCCTTTCTGTGTCATCATCAATGACGTTTTGCCTCACAATCTACTAGCAGAGATTTTCGTTCGTCTTCATTTGAGAGATGTGTTTCGCTGTA
TGGCTGTTTGCAAGCTCTGGTGCTCTCTTATCCGATACGATCCAAGTTTCAAAGTGGAGTTTACCCTCAAGAAAATTGAGGGGGATCAACTACTAATTTC
TGCAAAATGCACTGTCAATGAGTTGTTTCTGGTCACTACCACTGGCAATATCTCCAATGGGCTAGCTAGACTTATCTTTGGATTTTCCAACGGCTTGGTA
CTGTGCCCCCCAGCGGGAACAACCTTGCGGGCTGCGTACTACGTTTGCAACCCGCTAACGAAGCAGTTTGTCATGCTTCCACCATCTCCTTGGTCTGATT
ATCACATGTATACGGGTTTTATCTGTGATGGAGTGCGACTTTGA
AA sequence
>Lus10037619 pacid=23167077 polypeptide=Lus10037619 locus=Lus10037619.g ID=Lus10037619.BGIv1.0 annot-version=v1.0
MEIPFCVIINDVLPHNLLAEIFVRLHLRDVFRCMAVCKLWCSLIRYDPSFKVEFTLKKIEGDQLLISAKCTVNELFLVTTTGNISNGLARLIFGFSNGLV
LCPPAGTTLRAAYYVCNPLTKQFVMLPPSPWSDYHMYTGFICDGVRL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G49610 F-box family protein (.1) Lus10037619 0 1
Lus10024528 22.0 0.6079
AT1G27350 Ribosome associated membrane p... Lus10011355 24.4 0.6089
AT2G34930 disease resistance family prot... Lus10016326 24.7 0.5132
AT2G25660 EMB2410 embryo defective 2410 (.1) Lus10012415 41.2 0.5312
AT5G17680 disease resistance protein (TI... Lus10005588 44.0 0.5675
AT2G33710 AP2_ERF Integrase-type DNA-binding sup... Lus10016245 66.1 0.4647
AT5G05570 transducin family protein / WD... Lus10030399 133.0 0.5095
AT4G15780 ATVAMP724 vesicle-associated membrane pr... Lus10037511 188.2 0.4668
AT1G25275 unknown protein Lus10004192 196.0 0.4644
AT1G24625 C2H2ZnF ZFP7 zinc finger protein 7 (.1) Lus10043380 249.8 0.4459

Lus10037619 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.