Lus10037626 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13882 157 / 2e-50 Ribosomal protein L34 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015609 268 / 2e-93 AT3G13882 134 / 2e-40 Ribosomal protein L34 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G041100 150 / 9e-48 AT3G13882 154 / 6e-49 Ribosomal protein L34 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00468 Ribosomal_L34 Ribosomal protein L34
Representative CDS sequence
>Lus10037626 pacid=23167056 polypeptide=Lus10037626 locus=Lus10037626.g ID=Lus10037626.BGIv1.0 annot-version=v1.0
ATGTCGTCGAAAACGCTAGTCCAGAGCGGAGCCTCTCTGATGAACCGGTTGCTCTTCCGTTCAAATCCGATTTCCCACCAGAAGATCTCTATCTTGCAGA
ATCACTCCCAGGGGATCGCTCCTCCTCTGCTATTCCCTTCCCTCCACAAGTTCCAGGCTCCTTCCGGCGATTCGTCTAGAATCGACGACTTCAATTCGAT
CCAGAGAATCGCCAATGAAGGATTCCTGAATCCCTGCGGCCTCCCTTCTCTTGACTTCTTCTTGCCTGAAGCTGATTCAGCTGATGAAGCGATGATCTTG
CTTCCGAAAAGGACGTTCCAACCTAGCACCATCAAGCGTAAGAGAACCCATGGATTCTTTGCACGCAAGGCAACCAAGGGTGGCCGGAAAGTCATTGCTC
GACGAGTGGCGAAAGGCCGGTTCAGAATTACAGCCTAA
AA sequence
>Lus10037626 pacid=23167056 polypeptide=Lus10037626 locus=Lus10037626.g ID=Lus10037626.BGIv1.0 annot-version=v1.0
MSSKTLVQSGASLMNRLLFRSNPISHQKISILQNHSQGIAPPLLFPSLHKFQAPSGDSSRIDDFNSIQRIANEGFLNPCGLPSLDFFLPEADSADEAMIL
LPKRTFQPSTIKRKRTHGFFARKATKGGRKVIARRVAKGRFRITA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G13882 Ribosomal protein L34 (.1.2) Lus10037626 0 1
AT3G13882 Ribosomal protein L34 (.1.2) Lus10015609 1.0 0.9003
AT5G04800 Ribosomal S17 family protein (... Lus10021307 4.0 0.8538
AT1G09590 Translation protein SH3-like f... Lus10021079 6.7 0.8549
AT1G73940 unknown protein Lus10017355 8.0 0.8382
AT4G15000 Ribosomal L27e protein family ... Lus10039017 8.1 0.8496
AT5G57120 unknown protein Lus10001627 9.5 0.8426
AT2G33840 Tyrosyl-tRNA synthetase, class... Lus10029613 10.0 0.7803
AT5G48480 Lactoylglutathione lyase / gly... Lus10009579 11.2 0.8662
AT1G14620 XTR2, EXGT-A2, ... decoy (.1.2) Lus10012875 20.2 0.8090
AT2G03530 ATUPS2, UPS2 ARABIDOPSIS THALIANA UREIDE PE... Lus10036911 22.8 0.8272

Lus10037626 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.