Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07745 108 / 9e-30 SSN1, ATRAD51D, RAD51D SUPPRESOR OF SNI1, homolog of RAD51 D (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015220 [exp] 147 / 1e-44 AT1G07745 273 / 6e-91 SUPPRESOR OF SNI1, homolog of RAD51 D (.1.2) Lus10005437 [exp] 141 / 1e-41 AT1G07745 231 / 1e-73 SUPPRESOR OF SNI1, homolog of RAD51 D (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037642 pacid=23167372 polypeptide=Lus10037642 locus=Lus10037642.g ID=Lus10037642.BGIv1.0 annot-version=v1.0 ATGAGCAGAATGCTCTGTCACTCAGTTTTCGACATATATTTGCTGTTTGATGTGCTACACCAGTTGGGGTTCAAGTTGAGATCCCAGCTTGTTCGTCGCG TTAAATGCGAAGGGCATGCTTTGATGATGTCACTAGGGTTCTTGCTGAAGAAGCATGAGCACAACATTGCAGTACTGGTGACGAACCATATGGTGGGCGG AGAAGGCGGGACTCTGAAACCGGCTATTGGAGAGAGTCGGAAGAGTATTCCACATCTGAGGCTGCTGATCTCTCGTAGCCATGGAACCAATGCTTGCTTC AACGTTCACCCTTTAGTGGCTTCTGGGAAGTCAGCAAGCTTTACCATGGAGTAG
AA sequence Show only first row Show all	>Lus10037642 pacid=23167372 polypeptide=Lus10037642 locus=Lus10037642.g ID=Lus10037642.BGIv1.0 annot-version=v1.0 MSRMLCHSVFDIYLLFDVLHQLGFKLRSQLVRRVKCEGHALMMSLGFLLKKHEHNIAVLVTNHMVGGEGGTLKPAIGESRKSIPHLRLLISRSHGTNACF NVHPLVASGKSASFTME

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07745		SSN1, ATRAD51D,...	SUPPRESOR OF SNI1, homolog of ...		Lus10037642 [exp]	0	1
AT1G08790			Protein of unknown function (D...		Lus10042536 [exp]	5.1	0.7224
AT1G29430			SAUR-like auxin-responsive pro...		Lus10007059 [exp]	10.0	0.6842
					Lus10034545 [exp]	11.2	0.6842
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10016168 [exp]	12.2	0.6842
AT4G16195			Plant self-incompatibility pro...		Lus10017929 [exp]	13.2	0.6842
AT5G67090			Subtilisin-like serine endopep...		Lus10002044 [exp]	14.1	0.6842
AT5G57480			P-loop containing nucleoside t...		Lus10025479 [exp]	33.3	0.6782
AT3G08720		ATPK2, ATPK19, ...	ARABIDOPSIS THALIANA SERINE/TH...		Lus10022732 [exp]	44.2	0.5827
					Lus10001089 [exp]	56.1	0.6432
AT5G08020		ATRPA70B	ARABIDOPSIS THALIANA RPA70-KDA...		Lus10042979 [exp]	56.4	0.5457

Compare expression of checked genes

Lus10037642 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.