Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44670 81 / 2e-18 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT3G44480 81 / 3e-18 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G25510 80 / 7e-18 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G11250 80 / 7e-18 Disease resistance protein (TIR-NBS-LRR class) (.1) AT3G44630 79 / 2e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT3G04220 78 / 3e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G40910 77 / 6e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G69550 75 / 3e-16 disease resistance protein (TIR-NBS-LRR class) (.1) AT5G41540 74 / 5e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G48770 74 / 5e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015648 [exp] 244 / 2e-75 AT4G12010 420 / 1e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10007030 [exp] 206 / 2e-63 AT4G12010 316 / 3e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10010222 [exp] 191 / 1e-61 AT4G11170 169 / 2e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10015650 [exp] 199 / 3e-60 AT4G12010 346 / 3e-103 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10017418 [exp] 195 / 3e-58 AT5G44510 335 / 1e-96 target of AVRB operation1 (.1) Lus10024149 [exp] 181 / 6e-56 AT4G19510 213 / 8e-61 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) Lus10010221 [exp] 184 / 2e-54 AT5G17680 369 / 4e-109 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10017419 [exp] 179 / 2e-54 AT4G12010 272 / 9e-80 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10042777 [exp] 162 / 6e-51 AT3G44630 136 / 2e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G010800 [exp] 93 / 2e-22 AT5G17680 592 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G113701 [exp] 92 / 5e-22 AT5G17680 596 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G068200 [exp] 89 / 3e-21 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.004G088500 [exp] 87 / 2e-20 AT1G69550 647 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1) Potri.019G070700 [exp] 87 / 3e-20 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G095932 [exp] 86 / 6e-20 AT4G11170 294 / 5e-88 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G098900 [exp] 85 / 1e-19 AT5G17680 477 / 6e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G097100 [exp] 84 / 2e-19 AT4G12010 521 / 8e-165 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.005G030318 [exp] 83 / 5e-19 AT1G69550 673 / 0.0 disease resistance protein (TIR-NBS-LRR class) (.1) Potri.019G069500 [exp] 79 / 9e-18 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037667 pacid=23167239 polypeptide=Lus10037667 locus=Lus10037667.g ID=Lus10037667.BGIv1.0 annot-version=v1.0 ATGAAGAAAGTTGGGCACCAAGTTCTTCCGATTTTCTTTAAAGTGGATCCGTTCGATGTGACAGATGAATCTAGAAGCTATATGGCTACCATCGATCGAG AATGTAAAGGTAGAAGTACTTCTTTCAAGGATAAGAAGCGATGGATGGATGCTTTGAAAGCTGTGGCTATGTCTGCTGGTCATACTTCGCAGGCCATCAA AATTGAATCGGAATCAATTAAGGCGATTGTGGAAACAGTTCAGAAGCAACTAATTGACATGTCACCGAGTATTAATCCTAATAACTTGGTTGCTATGGGT TCACGCATTTTGGAGGTTGAACGACTATTAACTACGGACAAATTAGATGCTACTTGCATCATTGGGCTATGGAGAATGGGCGGTGTTGGGAAAACAACTC TAGCCAAAGCGTGTTATGACGGGGTGAGGAATCAGATGGTCAAGCTAGAGGGTCTACAGTTAATGGACGGAAAGTGA
AA sequence Show only first row Show all	>Lus10037667 pacid=23167239 polypeptide=Lus10037667 locus=Lus10037667.g ID=Lus10037667.BGIv1.0 annot-version=v1.0 MKKVGHQVLPIFFKVDPFDVTDESRSYMATIDRECKGRSTSFKDKKRWMDALKAVAMSAGHTSQAIKIESESIKAIVETVQKQLIDMSPSINPNNLVAMG SRILEVERLLTTDKLDATCIIGLWRMGGVGKTTLAKACYDGVRNQMVKLEGLQLMDGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44670			Disease resistance protein (TI...		Lus10037667 [exp]	0	1
AT5G18560	AP2_ERF	PUCHI	Integrase-type DNA-binding sup...		Lus10026053 [exp]	3.2	0.8125
AT3G45400			exostosin family protein (.1)		Lus10005684 [exp]	6.5	0.8162
AT1G19250		FMO1	flavin-dependent monooxygenase...		Lus10013230 [exp]	6.6	0.8424
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Lus10003302 [exp]	8.1	0.7704
AT2G02955		MEE12	maternal effect embryo arrest ...		Lus10012828 [exp]	12.0	0.7155
					Lus10029487 [exp]	13.5	0.7345
					Lus10022056 [exp]	15.7	0.7245
AT4G35190		LOG5	LONELY GUY 5, Putative lysine ...		Lus10003335 [exp]	16.5	0.8333
AT4G38590		BGAL14	beta-galactosidase 14 (.1.2)		Lus10014125 [exp]	18.4	0.7281
AT3G28370			unknown protein		Lus10014503 [exp]	33.4	0.8097

Compare expression of checked genes

Lus10037667 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.