Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14075 124 / 2e-34 Mono-/di-acylglycerol lipase, N-terminal;Lipase, class 3 (.1.2) AT4G16070 90 / 3e-22 Mono-/di-acylglycerol lipase, N-terminal;Lipase, class 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015680 [exp] 148 / 7e-43 AT3G14075 744 / 0.0 Mono-/di-acylglycerol lipase, N-terminal;Lipase, class 3 (.1.2) Lus10008121 [exp] 124 / 2e-34 AT3G14075 763 / 0.0 Mono-/di-acylglycerol lipase, N-terminal;Lipase, class 3 (.1.2) Lus10013158 [exp] 114 / 8e-31 AT3G14075 754 / 0.0 Mono-/di-acylglycerol lipase, N-terminal;Lipase, class 3 (.1.2) Lus10016834 [exp] 80 / 2e-18 AT4G16070 750 / 0.0 Mono-/di-acylglycerol lipase, N-terminal;Lipase, class 3 (.1.2) Lus10037710 [exp] 76 / 3e-17 AT4G16070 764 / 0.0 Mono-/di-acylglycerol lipase, N-terminal;Lipase, class 3 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G067900 [exp] 113 / 1e-30 AT3G14075 752 / 0.0 Mono-/di-acylglycerol lipase, N-terminal;Lipase, class 3 (.1.2) Potri.008G211200 [exp] 96 / 2e-24 AT4G16070 751 / 0.0 Mono-/di-acylglycerol lipase, N-terminal;Lipase, class 3 (.1.2) Potri.010G005800 [exp] 89 / 6e-22 AT4G16070 715 / 0.0 Mono-/di-acylglycerol lipase, N-terminal;Lipase, class 3 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF03893 [flax] [poplar] Lipase3_N Lipase 3 N-terminal region
Representative CDS sequence Show only first row Show all	>Lus10037690 pacid=23167281 polypeptide=Lus10037690 locus=Lus10037690.g ID=Lus10037690.BGIv1.0 annot-version=v1.0 ATGGCGACAGCAACAATGGCGACTGGAGCTGGTGCGGCTGCTCTTTTGTACTACACTCTGAACCGTAAACTACAGACTGGTGAATCCAATCATGATGATG ATGACGAGAATGGTACAGCTACCAGGATGCGGTTGGGGATCAATCGAGTCTCGAGTAGATTGATTCAAGCCCCTGGTACATGGTTGGAGACGATCTCCAC TTTGTCTGAGACTTTGAGGTTCACATACTCTGAGACCCTTGGCAAGTGGCCCATTGCTGACTTGGCGTTTGGGATCAACTTCTTGTTGAAAAGGCAGGTG AGCTCTCATTGTAATCTTGAACTTTAG
AA sequence Show only first row Show all	>Lus10037690 pacid=23167281 polypeptide=Lus10037690 locus=Lus10037690.g ID=Lus10037690.BGIv1.0 annot-version=v1.0 MATATMATGAGAAALLYYTLNRKLQTGESNHDDDDENGTATRMRLGINRVSSRLIQAPGTWLETISTLSETLRFTYSETLGKWPIADLAFGINFLLKRQV SSHCNLEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14075			Mono-/di-acylglycerol lipase, ...		Lus10037690 [exp]	0	1
AT5G22660			FBD, F-box, Skp2-like and Leuc...		Lus10017530 [exp]	15.7	0.8362
AT4G18930			RNA ligase/cyclic nucleotide p...		Lus10002767 [exp]	16.9	0.8714
AT5G55310		TOP1alpha, TOP1...	DNA topoisomerase 1 beta (.1)		Lus10043172 [exp]	46.6	0.8085
AT2G43610			Chitinase family protein (.1)		Lus10025948 [exp]	108.7	0.8209
AT2G41950			unknown protein		Lus10016243 [exp]	114.3	0.8060
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10020550 [exp]	148.6	0.7981
AT5G64300		ATGCH, ATRIBA1,...	RED FLUORESCENT IN DARKNESS 1,...		Lus10023161 [exp]	168.6	0.7985
AT3G53270			Small nuclear RNA activating c...		Lus10008478 [exp]	194.5	0.8125
AT4G24730			Calcineurin-like metallo-phosp...		Lus10019465 [exp]	281.0	0.7928

Compare expression of checked genes

Lus10037690 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.