Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56710 171 / 1e-56 Ribosomal protein L31e family protein (.1.2) AT4G26230 170 / 5e-56 Ribosomal protein L31e family protein (.1) AT2G19740 167 / 8e-55 Ribosomal protein L31e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015698 [exp] 203 / 5e-69 AT5G56710 201 / 2e-68 Ribosomal protein L31e family protein (.1.2) Lus10025830 [exp] 170 / 5e-56 AT2G19740 200 / 5e-68 Ribosomal protein L31e family protein (.1) Lus10042028 [exp] 169 / 2e-55 AT2G19740 198 / 3e-67 Ribosomal protein L31e family protein (.1) Lus10018032 [exp] 162 / 1e-52 AT2G19740 191 / 3e-64 Ribosomal protein L31e family protein (.1) Lus10038272 [exp] 171 / 5e-52 AT2G19740 200 / 9e-63 Ribosomal protein L31e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G269600 [exp] 178 / 4e-59 AT2G19740 162 / 5e-53 Ribosomal protein L31e family protein (.1) Potri.009G064100 [exp] 177 / 7e-59 AT2G19740 164 / 1e-53 Ribosomal protein L31e family protein (.1) Potri.018G070100 [exp] 168 / 2e-55 AT2G19740 170 / 6e-56 Ribosomal protein L31e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01198 [flax] [poplar] Ribosomal_L31e Ribosomal protein L31e
Representative CDS sequence Show only first row Show all	>Lus10037703 pacid=23167126 polypeptide=Lus10037703 locus=Lus10037703.g ID=Lus10037703.BGIv1.0 annot-version=v1.0 ATGGCGGAAAAGCCCAGGAAAGTTAGGAAGGAGGAGATTGTCACCAGAGAATACACCATAAACCTCCACAAACGCCTCCATGGATGCACTTTCAAGAAGA AGGCACCAAAGGCGATTAAGGAGATAAGGAAGTTCGCTCAGAAGGCCATGGGAACAACTGATTGCAGAGTCGACGTGAAGCTGAACAAGCAGATCTGGAG CAAAGGGATCAGGAGTGTGCCGAGGAGGGTTCGTGTTCGTATTGCGAGGAAGAGGAACGACGAGGAAGATGCCAAGGAAGAGTTCTACTCTCTTGTCACC GTTGCTGAGATTTCTGAGGAAGGTTTTAAGGGGTTGGGGACTAAGGTCATCGACGAGGAAGATTAG
AA sequence Show only first row Show all	>Lus10037703 pacid=23167126 polypeptide=Lus10037703 locus=Lus10037703.g ID=Lus10037703.BGIv1.0 annot-version=v1.0 MAEKPRKVRKEEIVTREYTINLHKRLHGCTFKKKAPKAIKEIRKFAQKAMGTTDCRVDVKLNKQIWSKGIRSVPRRVRVRIARKRNDEEDAKEEFYSLVT VAEISEEGFKGLGTKVIDEED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G56710			Ribosomal protein L31e family ...		Lus10037703 [exp]	0	1
AT5G56710			Ribosomal protein L31e family ...		Lus10015698 [exp]	1.0	0.9689
AT2G44820			unknown protein		Lus10036053 [exp]	1.4	0.9503
AT5G40080			Mitochondrial ribosomal protei...		Lus10003002 [exp]	2.8	0.9340
AT3G10090			Nucleic acid-binding, OB-fold-...		Lus10016222 [exp]	3.5	0.9400
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Lus10022882 [exp]	3.6	0.9307
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10020499 [exp]	6.9	0.9359
AT5G27700			Ribosomal protein S21e (.1)		Lus10015173 [exp]	7.1	0.9467
AT4G14320			Zinc-binding ribosomal protein...		Lus10000176 [exp]	8.7	0.9381
AT1G41880			Ribosomal protein L35Ae family...		Lus10028254 [exp]	10.2	0.9357
AT2G20450			Ribosomal protein L14 (.1)		Lus10008246 [exp]	10.2	0.9236

Compare expression of checked genes

Lus10037703 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.