Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06740 147 / 4e-46 GATA GATA15 GATA transcription factor 15 (.1) AT5G49300 142 / 2e-44 GATA GATA16 GATA transcription factor 16 (.1) AT3G16870 105 / 4e-29 GATA GATA17 GATA transcription factor 17 (.1) AT4G16141 96 / 2e-25 GATA GATA type zinc finger transcription factor family protein (.1) AT5G26930 70 / 5e-16 GATA GATA23 GATA transcription factor 23 (.1) AT5G56860 68 / 5e-14 GATA GATA21, GNC GATA, nitrate-inducible, carbon metabolism-involved, GATA TRANSCRIPTION FACTOR 21, GATA type zinc finger transcription factor family protein (.1) AT4G26150 65 / 5e-13 GATA GATA22, CGA1, GNL GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) AT2G18380 63 / 9e-13 GATA GATA20, HANL1 hanaba taranu like 1, GATA transcription factor 20 (.1) AT4G36620 63 / 1e-12 GATA GATA19, HANL2 hanaba taranu like 2, GATA transcription factor 19 (.1) AT3G50870 63 / 2e-12 GATA GATA18, HAN, MNP MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016849 [exp] 265 / 8e-93 AT3G06740 154 / 6e-49 GATA transcription factor 15 (.1) Lus10029863 [exp] 75 / 4e-17 AT4G16141 90 / 1e-22 GATA type zinc finger transcription factor family protein (.1) Lus10020684 [exp] 74 / 5e-17 AT4G16141 94 / 9e-24 GATA type zinc finger transcription factor family protein (.1) Lus10031464 [exp] 66 / 5e-14 AT3G24050 69 / 3e-15 GATA transcription factor 1 (.1) Lus10036329 [exp] 67 / 1e-13 AT1G02700 189 / 1e-57 unknown protein Lus10010027 [exp] 62 / 6e-13 AT5G49300 87 / 8e-23 GATA transcription factor 16 (.1) Lus10028301 [exp] 62 / 2e-12 AT3G50870 135 / 4e-39 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Lus10037398 [exp] 57 / 2e-10 AT1G08010 169 / 1e-50 GATA transcription factor 11 (.1.2) Lus10038273 [exp] 57 / 3e-10 AT4G32890 219 / 1e-69 GATA transcription factor 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G001300 [exp] 167 / 4e-54 AT3G06740 135 / 2e-41 GATA transcription factor 15 (.1) Potri.008G213900 [exp] 150 / 2e-47 AT3G06740 126 / 4e-38 GATA transcription factor 15 (.1) Potri.002G199800 [exp] 103 / 8e-29 AT5G49300 112 / 1e-32 GATA transcription factor 16 (.1) Potri.005G020500 [exp] 101 / 5e-28 AT3G06740 67 / 1e-14 GATA transcription factor 15 (.1) Potri.014G124400 [exp] 99 / 3e-27 AT5G49300 106 / 2e-30 GATA transcription factor 16 (.1) Potri.006G229200 [exp] 66 / 1e-13 AT4G26150 111 / 3e-28 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.007G024500 [exp] 62 / 2e-12 AT3G50870 202 / 5e-64 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Potri.005G122700 [exp] 62 / 3e-12 AT3G50870 198 / 1e-62 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Potri.018G053600 [exp] 61 / 2e-11 AT4G26150 75 / 4e-15 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.006G237700 [exp] 56 / 9e-10 AT5G25830 246 / 2e-79 GATA transcription factor 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00320 [flax] [poplar] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Lus10037721 pacid=23167057 polypeptide=Lus10037721 locus=Lus10037721.g ID=Lus10037721.BGIv1.0 annot-version=v1.0 ATGCTTGATCGGAGTGAAAAAGTTCTTCAAGTCAGCCGTAAATCCTCGCCGGAAGGAGGAGAGAGTCCGCAGAAGAAAACATGCGCCGATTGCGGAACCA GCAAAACTCCTCTATGGAGAGGCGGCCCAGCTGGACCTAAGTCGCTTTGCAACGCGTGTGGGATCAGAAGCAGGAAGAAGAGAAGGGATGTATTGGGTTT GACCAAATCATCCTCTAACGACAAGAAAGTGAAGAAGTCCGTGAGCAATCACATTAACGGCGGAGTTCATGACGGTAGCAAAAATAATCACAGTAAGCTG CGAGATGGGTTGAAGCAGAGATTGATGGCGTTGGGAAGGGAAGTGATGATGCAGAGATCGACGGTGGAGAAGCAGAGAAGGCAGCTGGGTGAGGAAGAGC AAGCGGCGGTTCTGTTGATGGCTCTATCTTATGGATCCGTTTATGCCTAG
AA sequence Show only first row Show all	>Lus10037721 pacid=23167057 polypeptide=Lus10037721 locus=Lus10037721.g ID=Lus10037721.BGIv1.0 annot-version=v1.0 MLDRSEKVLQVSRKSSPEGGESPQKKTCADCGTSKTPLWRGGPAGPKSLCNACGIRSRKKRRDVLGLTKSSSNDKKVKKSVSNHINGGVHDGSKNNHSKL RDGLKQRLMALGREVMMQRSTVEKQRRQLGEEEQAAVLLMALSYGSVYA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G06740	GATA	GATA15	GATA transcription factor 15 (...		Lus10037721 [exp]	0	1
AT3G06740	GATA	GATA15	GATA transcription factor 15 (...		Lus10016849 [exp]	2.8	0.7680
AT3G18050			unknown protein		Lus10027253 [exp]	6.3	0.7752
AT3G07360		ATPUB9	ARABIDOPSIS THALIANA PLANT U-B...		Lus10020413 [exp]	6.9	0.7886
AT5G20500			Glutaredoxin family protein (....		Lus10021590 [exp]	9.3	0.7690
AT4G04900		RIC10	ROP-interactive CRIB motif-con...		Lus10018362 [exp]	14.1	0.7553
AT4G28310			unknown protein		Lus10033688 [exp]	15.2	0.7509
AT5G25170			PPPDE putative thiol peptidase...		Lus10005341 [exp]	18.4	0.7323
AT1G69390		ARC12, ATMINE1	accumulation and replication o...		Lus10036802 [exp]	25.2	0.7649
AT2G35760			Uncharacterised protein family...		Lus10038800 [exp]	25.9	0.7242
AT1G75060			unknown protein		Lus10018805 [exp]	27.8	0.7222

Compare expression of checked genes

Lus10037721 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.