Lus10037724 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016852 161 / 1e-53 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.T171001 80 / 2e-21 ND /
Potri.008G108801 79 / 6e-21 ND /
PFAM info
Representative CDS sequence
>Lus10037724 pacid=23167329 polypeptide=Lus10037724 locus=Lus10037724.g ID=Lus10037724.BGIv1.0 annot-version=v1.0
ATGTCTTCGGACAAGGGCAATGTTGAGGATCTGGAGGAGCCCTGCACCAGCAACAAACACGCAAGTCTTGCTGACAGAAAGCCTAATGCACAAGGCTCAG
GGAATTCTGGTTTAGAGAGAGCACTTGCACATAGAGCACTCTTTCGGTCACACAATAGCAGGGTGAAGGGGAGAAAATCCGTGAACAACATTGCCAGAAT
GTTGCCAAGCAGGCTAAGCAAGGTATCATTGGCAGATGATCCAGCTGACTAA
AA sequence
>Lus10037724 pacid=23167329 polypeptide=Lus10037724 locus=Lus10037724.g ID=Lus10037724.BGIv1.0 annot-version=v1.0
MSSDKGNVEDLEEPCTSNKHASLADRKPNAQGSGNSGLERALAHRALFRSHNSRVKGRKSVNNIARMLPSRLSKVSLADDPAD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10037724 0 1
AT2G38940 PHT1;4, ATPT2 ARABIDOPSIS THALIANA PHOSPHATE... Lus10033866 12.6 0.6865
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10006923 14.6 0.6448
AT3G14300 ATPMEPCRC, ATPM... A. THALIANA PECTIN METHYLESTER... Lus10010002 45.3 0.5442
AT1G19250 FMO1 flavin-dependent monooxygenase... Lus10038126 50.7 0.6109
Lus10017380 51.8 0.5993
AT1G54860 Glycoprotein membrane precurso... Lus10004470 76.6 0.5967
AT1G69930 ATGSTU11 glutathione S-transferase TAU ... Lus10029518 91.6 0.5810
Lus10009766 96.3 0.4928
AT4G30200 VEL1, VIL2 VIN3-Like 2, vernalization5/VI... Lus10040339 131.2 0.5621
AT1G03670 ankyrin repeat family protein ... Lus10013878 217.4 0.4931

Lus10037724 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.