Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G61550 50 / 2e-08 S-locus lectin protein kinase family protein (.1) AT1G61370 48 / 1e-07 S-locus lectin protein kinase family protein (.1) AT1G61390 47 / 2e-07 S-locus lectin protein kinase family protein (.1.2) AT1G11330 46 / 5e-07 S-locus lectin protein kinase family protein (.1.2) AT4G27290 45 / 7e-07 S-locus lectin protein kinase family protein (.1) AT1G61430 45 / 9e-07 S-locus lectin protein kinase family protein (.1) AT1G61440 45 / 2e-06 S-locus lectin protein kinase family protein (.1) AT4G21390 44 / 2e-06 B120 S-locus lectin protein kinase family protein (.1) AT4G03230 43 / 4e-06 S-locus lectin protein kinase family protein (.1) AT1G61480 43 / 6e-06 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016859 [exp] 107 / 1e-28 AT4G27290 626 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10037732 [exp] 105 / 8e-28 AT4G21380 768 / 0.0 receptor kinase 3 (.1) Lus10016860 [exp] 98 / 4e-25 AT4G21380 743 / 0.0 receptor kinase 3 (.1) Lus10037729 [exp] 92 / 4e-23 AT4G27290 750 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10016862 [exp] 92 / 4e-23 AT4G27290 702 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10016871 [exp] 88 / 1e-21 AT4G27290 752 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10037736 [exp] 83 / 2e-20 AT4G27290 203 / 1e-59 S-locus lectin protein kinase family protein (.1) Lus10034815 [exp] 59 / 2e-11 AT4G27290 186 / 3e-52 S-locus lectin protein kinase family protein (.1) Lus10033743 [exp] 56 / 1e-10 AT4G21380 608 / 0.0 receptor kinase 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G411000 [exp] 62 / 1e-12 AT4G27290 775 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G129300 [exp] 59 / 2e-11 AT4G21380 599 / 0.0 receptor kinase 3 (.1) Potri.001G410800 [exp] 56 / 1e-10 AT4G27290 758 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G411100 [exp] 56 / 3e-10 AT4G27290 746 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G411300 [exp] 55 / 4e-10 AT4G27290 759 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G418100 [exp] 54 / 5e-10 AT4G27290 778 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G411400 [exp] 53 / 1e-09 AT4G27290 770 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125050 [exp] 52 / 5e-09 AT4G27290 870 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G126151 [exp] 51 / 1e-08 AT4G27290 868 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G413800 [exp] 50 / 2e-08 AT4G27290 991 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037730 pacid=23167232 polypeptide=Lus10037730 locus=Lus10037730.g ID=Lus10037730.BGIv1.0 annot-version=v1.0 ATGGAGTGGTTGATGTTGCTTCTTCGTGCTGTTTATTATTTTCTCCTCTTACCCTCTTCTTTTGCACTTGAAGCTGTGACTCCAACCCAACCACTGATTG ACCATAATGCGCAGACCTTGCAGTCCAGAGATGGAACATTCGAGATGGGTTTCTTCACTCTTGGAGGCGTCGCATCCAAGAAGCGCTACTTGGGAATTTG GTACAGAAACATAGCTGATAGAAGAGTTGTTGGGTTGCTAATGGAGATAGTCCAACCACCGACAACAACAGCTCTTTGA
AA sequence Show only first row Show all	>Lus10037730 pacid=23167232 polypeptide=Lus10037730 locus=Lus10037730.g ID=Lus10037730.BGIv1.0 annot-version=v1.0 MEWLMLLLRAVYYFLLLPSSFALEAVTPTQPLIDHNAQTLQSRDGTFEMGFFTLGGVASKKRYLGIWYRNIADRRVVGLLMEIVQPPTTTAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G61550			S-locus lectin protein kinase ...		Lus10037730 [exp]	0	1
AT4G27290			S-locus lectin protein kinase ...		Lus10037731 [exp]	1.7	0.9254
AT1G14790		ATRDRP1, RDR1	RNA-dependent RNA polymerase 1...		Lus10034390 [exp]	2.0	0.9242
AT1G27180			disease resistance protein (TI...		Lus10008519 [exp]	2.4	0.8541
AT5G22900		ATCHX3	cation/H+ exchanger 3, ARABIDO...		Lus10000154 [exp]	3.5	0.8183
AT3G11620		BAS1	alpha/beta-Hydrolases superfam...		Lus10004214 [exp]	4.5	0.8521
AT4G08250	GRAS		GRAS family transcription fact...		Lus10022664 [exp]	4.7	0.8239
AT1G27170			transmembrane receptors;ATP bi...		Lus10002232 [exp]	6.2	0.8151
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015749 [exp]	6.5	0.8378
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10020877 [exp]	7.5	0.8525
AT1G33970			P-loop containing nucleoside t...		Lus10003732 [exp]	8.4	0.8281

Compare expression of checked genes

Lus10037730 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.