Lus10037747 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16980 90 / 4e-24 NRPE9A, NRPD9A, NRPB9A RNA polymerases M/15 Kd subunit (.1)
AT4G16265 88 / 4e-23 NRPE9B, NRPD9B, NRPB9B RNA polymerases M/15 Kd subunit (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016880 114 / 1e-33 AT3G16980 157 / 6e-51 RNA polymerases M/15 Kd subunit (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G106900 98 / 6e-27 AT3G16980 216 / 1e-74 RNA polymerases M/15 Kd subunit (.1)
Potri.010G142500 76 / 1e-18 AT4G16265 146 / 3e-47 RNA polymerases M/15 Kd subunit (.1)
PFAM info
Representative CDS sequence
>Lus10037747 pacid=23167042 polypeptide=Lus10037747 locus=Lus10037747.g ID=Lus10037747.BGIv1.0 annot-version=v1.0
ATGAAAGGGTTCTTCTCTACGCTTGCCGTAACTGTGATCACCAGTGTTATCGGTGATGCAAACTTTAGCCTTTGGAACCTAACCTATCTTAAGTTGATCT
GCTGCCTTCCACCTGATCCTTGCTTGTTGTTCGATCTTTCAATTTATCAGGGGAAAACAATTTCAGAAGAAGTTGCTGAAACATACTGTGTATATAGAAA
CGAGGTTCATCATTCTGCAGCAGAACGCACTCAGGTATTGCAGGATGTAGCTGCTGATCCTACTCTCCCTCGCACCAAAGATGTTAGATGTGCTGTGTGT
AAGCATCCTGAAGCTGTCTTTTTCCAGGTTGCGGACACCGTTGGAGAGACTGAGACTTGTGGTAGAGGATCGATCAAAAGATGGGACTCGAAAAATGCAC
CTTCTAATGTTAGGTGTGCTGCACAGCCACTGCATACCATGGAATCTTGA
AA sequence
>Lus10037747 pacid=23167042 polypeptide=Lus10037747 locus=Lus10037747.g ID=Lus10037747.BGIv1.0 annot-version=v1.0
MKGFFSTLAVTVITSVIGDANFSLWNLTYLKLICCLPPDPCLLFDLSIYQGKTISEEVAETYCVYRNEVHHSAAERTQVLQDVAADPTLPRTKDVRCAVC
KHPEAVFFQVADTVGETETCGRGSIKRWDSKNAPSNVRCAAQPLHTMES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16980 NRPE9A, NRPD9A,... RNA polymerases M/15 Kd subuni... Lus10037747 0 1
AT3G27060 ATTSO2, TSO2 TSO MEANING 'UGLY' IN CHINESE ... Lus10032043 5.1 0.8227
AT1G80530 Major facilitator superfamily ... Lus10001678 7.1 0.8573
AT4G21430 B160 Zinc finger, RING-type;Transcr... Lus10020084 8.8 0.8679
AT5G07590 Transducin/WD40 repeat-like su... Lus10032495 16.1 0.8511
AT1G06220 GFA1, CLO, MEE5 MATERNAL EFFECT EMBRYO ARREST ... Lus10043478 18.5 0.8624
AT4G34860 A/N-InvB alkaline/neutral invertase B, ... Lus10026284 23.4 0.8418
AT5G43250 CCAAT NF-YC13 "nuclear factor Y, subunit C13... Lus10030657 24.5 0.8505
AT3G09670 Tudor/PWWP/MBT superfamily pro... Lus10016267 25.9 0.8045
AT1G62500 Bifunctional inhibitor/lipid-t... Lus10028930 28.9 0.8261
AT2G40510 Ribosomal protein S26e family ... Lus10029042 29.3 0.8369

Lus10037747 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.