Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16260 74 / 2e-17 Glycosyl hydrolase superfamily protein (.1) AT3G57260 71 / 4e-16 AtPR2, PR-2, PR2, BG2, BGL2 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1) AT3G57240 71 / 4e-16 BG3 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1) AT3G57270 66 / 1e-14 BG1 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) AT5G20390 53 / 6e-10 Glycosyl hydrolase superfamily protein (.1) AT5G20340 53 / 6e-10 BG5 beta-1,3-glucanase 5 (.1) AT1G33220 49 / 1e-08 Glycosyl hydrolase superfamily protein (.1) AT5G20330 48 / 5e-08 BETAG4 "beta-1,3-glucanase 4", beta-1,3-glucanase 4 (.1) AT5G42720 47 / 1e-07 Glycosyl hydrolase family 17 protein (.1) AT5G20560 47 / 1e-07 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016883 [exp] 114 / 3e-32 AT4G16260 391 / 1e-136 Glycosyl hydrolase superfamily protein (.1) Lus10027859 [exp] 79 / 5e-20 AT3G57240 185 / 4e-58 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1) Lus10019801 [exp] 81 / 8e-20 AT3G57270 367 / 6e-127 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Lus10014109 [exp] 81 / 8e-20 AT3G57270 361 / 1e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Lus10014108 [exp] 81 / 2e-19 AT3G57270 366 / 3e-123 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Lus10002807 [exp] 79 / 3e-19 AT3G57240 339 / 7e-116 "beta-1,3-glucanase 3", beta-1,3-glucanase 3 (.1) Lus10027860 [exp] 70 / 1e-15 AT3G57260 322 / 4e-109 PATHOGENESIS-RELATED PROTEIN 2, "beta-1,3-glucanase 2", beta-1,3-glucanase 2 (.1) Lus10014110 [exp] 67 / 7e-15 AT3G57270 359 / 2e-124 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Lus10019800 [exp] 65 / 2e-14 AT3G57270 238 / 1e-77 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G046100 [exp] 81 / 7e-20 AT3G57270 370 / 4e-128 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Potri.016G057600 [exp] 79 / 4e-19 AT3G57270 414 / 2e-145 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Potri.016G057400 [exp] 76 / 5e-18 AT3G57270 416 / 4e-146 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Potri.010G142800 [exp] 76 / 8e-18 AT4G16260 433 / 2e-152 Glycosyl hydrolase superfamily protein (.1) Potri.010G143166 [exp] 73 / 3e-17 AT4G16260 432 / 5e-153 Glycosyl hydrolase superfamily protein (.1) Potri.006G048100 [exp] 73 / 4e-17 AT3G57270 382 / 6e-133 "beta-1,3-glucanase 1", beta-1,3-glucanase 1 (.1) Potri.001G255100 [exp] 66 / 2e-14 AT4G16260 369 / 9e-128 Glycosyl hydrolase superfamily protein (.1) Potri.009G050300 [exp] 59 / 6e-12 AT4G16260 285 / 5e-95 Glycosyl hydrolase superfamily protein (.1) Potri.009G050401 [exp] 57 / 2e-11 AT4G16260 263 / 2e-87 Glycosyl hydrolase superfamily protein (.1) Potri.005G172000 [exp] 53 / 7e-10 AT1G77780 338 / 6e-115 Glycosyl hydrolase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00332 [flax] [poplar] Glyco_hydro_17 Glycosyl hydrolases family 17
Representative CDS sequence Show only first row Show all	>Lus10037749 pacid=23167370 polypeptide=Lus10037749 locus=Lus10037749.g ID=Lus10037749.BGIv1.0 annot-version=v1.0 ATGGAGCGCCTAGGAGGGTGGTCCGTGGAGGTGGTGGTTTCCGAGAGCGGGTGGCCCTCAGCTGGAGCCGGGGCCGCGACCACGATGGATAACACGCGCG TGTTCTACACGAACTTGGTCCAGCAGGTGAAGCGCGGGAGCCCCAAGAGGCCCAATAAGGCTATCGAGACGTACTTGTTTGCTATGTTTGATGAGAATCA GAAGGATCCTGAGTTGTAG
AA sequence Show only first row Show all	>Lus10037749 pacid=23167370 polypeptide=Lus10037749 locus=Lus10037749.g ID=Lus10037749.BGIv1.0 annot-version=v1.0 MERLGGWSVEVVVSESGWPSAGAGAATTMDNTRVFYTNLVQQVKRGSPKRPNKAIETYLFAMFDENQKDPEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16260			Glycosyl hydrolase superfamily...		Lus10037749 [exp]	0	1
AT4G16260			Glycosyl hydrolase superfamily...		Lus10016883 [exp]	1.4	0.9781
AT1G22430			GroES-like zinc-binding dehydr...		Lus10004785 [exp]	2.4	0.9615
AT3G26270		CYP71B25	"cytochrome P450, family 71, s...		Lus10019463 [exp]	3.5	0.9625
AT3G48310		CYP71A22	"cytochrome P450, family 71, s...		Lus10019462 [exp]	4.5	0.9610
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10037209 [exp]	4.5	0.9543
AT3G62890			Pentatricopeptide repeat (PPR)...		Lus10033544 [exp]	5.7	0.9044
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10012479 [exp]	7.7	0.9202
AT5G44390			FAD-binding Berberine family p...		Lus10008410 [exp]	8.1	0.9199
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10019183 [exp]	8.4	0.9501
AT4G11650		ATOSM34	osmotin 34 (.1)		Lus10024511 [exp]	8.5	0.9541

Compare expression of checked genes

Lus10037749 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.