Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17020 224 / 5e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G53990 166 / 3e-53 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G03270 160 / 6e-51 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G09740 82 / 7e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 77 / 5e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G58450 76 / 2e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G11360 76 / 3e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G68300 72 / 2e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 71 / 5e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G54430 65 / 4e-13 ATPHOS32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016900 [exp] 331 / 7e-113 AT3G17020 229 / 1e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10022602 [exp] 169 / 2e-54 AT3G53990 225 / 2e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021104 [exp] 162 / 2e-51 AT3G53990 215 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10017207 [exp] 161 / 4e-51 AT3G53990 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021501 [exp] 97 / 2e-26 AT3G53990 144 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10009272 [exp] 73 / 1e-16 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 72 / 3e-16 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 69 / 5e-15 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10031594 [exp] 70 / 1e-14 AT1G11360 257 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G144100 [exp] 241 / 1e-82 AT3G17020 234 / 3e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G104600 [exp] 172 / 2e-55 AT3G53990 229 / 6e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.006G092700 [exp] 165 / 7e-53 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.017G144301 [exp] 162 / 1e-51 AT3G03270 248 / 9e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.004G075375 [exp] 160 / 7e-51 AT3G03270 243 / 9e-84 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.002G104700 [exp] 81 / 2e-19 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.006G198200 [exp] 80 / 7e-19 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.016G064000 [exp] 79 / 2e-18 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.001G409100 [exp] 73 / 4e-16 AT5G54430 226 / 2e-74 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.011G039800 [exp] 69 / 1e-14 AT1G11360 269 / 3e-91 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10037761 pacid=23167061 polypeptide=Lus10037761 locus=Lus10037761.g ID=Lus10037761.BGIv1.0 annot-version=v1.0 ATGGGGGACAGGAGAATCGGAGTGGCCATGGATTTCTCGCCATGCAGCATTAAGGCGCTAAGATGGGCCATCGACAACCTCGTCCGCGACGGAGATCACC TCATCCTCCTCCACACCCGCTCCGCCGGCAAGTACGAATCCGGCGGCGAGATGCAGCTCTGGGAAACCACCGGCTCCCCGTTAATCCCTCTGGTGGAGGT CTCTCACCCGGAGACGATGAGCAAGTACGGAGTGAAGCCCGATCCGGAGACTCTCGATGTCCTCAACACGACTTCAAATCAAAAGAAGATTACAGTGGTG ATGAAGATCTACTGGGGAGACCCTCGTGAGAAGATATGCGAAGCGATGGAGCTGATCCCTCTCACTTCCCTTGTCATTGGGAATAGAGGGTTCGGTAAGC TCAAGAGGGTGATAATGGGGAGTGTGAGCAACTACGTGGTGGATAATGGAACTTGTCCGATCACTGTTGTCAAGGGCCCAGAACATGATGCTTGA
AA sequence Show only first row Show all	>Lus10037761 pacid=23167061 polypeptide=Lus10037761 locus=Lus10037761.g ID=Lus10037761.BGIv1.0 annot-version=v1.0 MGDRRIGVAMDFSPCSIKALRWAIDNLVRDGDHLILLHTRSAGKYESGGEMQLWETTGSPLIPLVEVSHPETMSKYGVKPDPETLDVLNTTSNQKKITVV MKIYWGDPREKICEAMELIPLTSLVIGNRGFGKLKRVIMGSVSNYVVDNGTCPITVVKGPEHDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G17020			Adenine nucleotide alpha hydro...		Lus10037761 [exp]	0	1
AT1G74520		ATHVA22A	HVA22 homologue A (.1)		Lus10023605 [exp]	3.2	0.8925
AT3G47860		CHL	chloroplastic lipocalin (.1)		Lus10035734 [exp]	3.2	0.8703
AT3G01570			Oleosin family protein (.1)		Lus10014559 [exp]	5.2	0.8706
AT1G30910			Molybdenum cofactor sulfurase ...		Lus10007754 [exp]	5.3	0.8643
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10014694 [exp]	9.2	0.8854
AT5G37980			Zinc-binding dehydrogenase fam...		Lus10004380 [exp]	9.8	0.8772
AT1G20340		PETE2, DRT112	PLASTOCYANIN 2, DNA-DAMAGE-REP...		Lus10034554 [exp]	11.1	0.8820
AT1G74520		ATHVA22A	HVA22 homologue A (.1)		Lus10024234 [exp]	12.4	0.8699
AT5G28840		GME	"GDP-D-mannose 3',5'-epimerase...		Lus10001777 [exp]	15.6	0.8400
AT1G16080			unknown protein		Lus10024094 [exp]	16.3	0.8771

Compare expression of checked genes

Lus10037761 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.