Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G06610 145 / 2e-46 DNA-binding enhancer protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016913 [exp] 206 / 2e-70 AT3G06610 164 / 5e-54 DNA-binding enhancer protein-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G105000 [exp] 165 / 2e-54 AT3G06610 137 / 2e-43 DNA-binding enhancer protein-related (.1) Potri.010G146100 [exp] 165 / 2e-54 AT3G06610 141 / 6e-45 DNA-binding enhancer protein-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037773 pacid=23167109 polypeptide=Lus10037773 locus=Lus10037773.g ID=Lus10037773.BGIv1.0 annot-version=v1.0 ATGGAGGCCGGTGATGAAGGAGTGGAGAGAGTTGAGGACTCGAAGGACATGCAGCAACAGAGCAAGGCCTTCGATAAGCTCACAGACCGGGTTGAGGATC GCCAGCTCGATTCCACCCGCGTCCAAGAGGCTATGGCGTCGATAGCTGCATCTTCCGAAGCTGATTGGAATGCCATGAGATTGAGGGAGAAAGAACTAGC TGCCGTGAAGATCAATCCAGCAGATATTGATGTAATCGCCAACGAATTGGAGTTGGACAAGAAAGTTGCGGAGAGGACACTGCGGGAGCACAAAGGAGAT GCTGTCGCGGCTATCCGGTACCTTCTGCAGCAGATTACTATTGGAATGAACTAG
AA sequence Show only first row Show all	>Lus10037773 pacid=23167109 polypeptide=Lus10037773 locus=Lus10037773.g ID=Lus10037773.BGIv1.0 annot-version=v1.0 MEAGDEGVERVEDSKDMQQQSKAFDKLTDRVEDRQLDSTRVQEAMASIAASSEADWNAMRLREKELAAVKINPADIDVIANELELDKKVAERTLREHKGD AVAAIRYLLQQITIGMN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G06610			DNA-binding enhancer protein-r...		Lus10037773 [exp]	0	1
AT4G00530			unknown protein		Lus10037854 [exp]	1.0	0.9029
AT1G20430			unknown protein		Lus10034561 [exp]	1.4	0.8877
AT3G18510			unknown protein		Lus10032475 [exp]	2.4	0.8875
AT1G07960		ATPDIL5-1	PDI-like 5-1 (.1.2.3)		Lus10036125 [exp]	2.8	0.8875
AT5G09830			BolA-like family protein (.1)		Lus10020861 [exp]	5.5	0.8851
AT2G42680		MBF1A, ATMBF1A	ARABIDOPSIS THALIANA MULTIPROT...		Lus10000056 [exp]	7.3	0.8807
AT5G66090			unknown protein		Lus10028414 [exp]	7.7	0.8231
AT4G08460			Protein of unknown function (D...		Lus10009772 [exp]	8.0	0.8415
AT1G65032			unknown protein		Lus10020483 [exp]	8.6	0.8164
AT2G34520		RPS14	mitochondrial ribosomal protei...		Lus10017877 [exp]	8.7	0.8425

Compare expression of checked genes

Lus10037773 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.