Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16230 42 / 1e-05 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G50400 40 / 6e-05 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G74460 39 / 0.0001 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G41890 38 / 0.0003 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016916 [exp] 117 / 4e-36 AT4G16230 61 / 2e-12 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10016918 [exp] 62 / 1e-12 AT2G23540 381 / 6e-131 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10037776 [exp] 55 / 2e-10 AT4G16230 188 / 2e-59 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10005236 [exp] 51 / 6e-09 AT2G23540 390 / 1e-134 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10005238 [exp] 49 / 6e-08 AT2G23540 369 / 2e-126 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10034459 [exp] 42 / 9e-06 AT1G74460 546 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10019095 [exp] 42 / 1e-05 AT1G74460 550 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10016775 [exp] 40 / 6e-05 AT2G23540 592 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10022471 [exp] 40 / 6e-05 AT2G23540 589 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G104600 [exp] 49 / 4e-08 AT2G23540 370 / 3e-127 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.008G104700 [exp] 39 / 8e-05 AT2G23540 280 / 1e-91 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008904 [exp] 38 / 0.0003 AT4G18970 246 / 3e-80 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Potri.019G005402 [exp] 38 / 0.0003 AT1G29670 341 / 3e-116 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008902 [exp] 37 / 0.0003 AT1G29670 342 / 2e-116 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008906 [exp] 37 / 0.0004 AT1G29670 345 / 1e-117 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008000 [exp] 37 / 0.0006 AT1G29670 347 / 1e-118 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008300 [exp] 37 / 0.0006 AT1G29670 318 / 6e-107 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037775 pacid=23167298 polypeptide=Lus10037775 locus=Lus10037775.g ID=Lus10037775.BGIv1.0 annot-version=v1.0 ATGGGTGGCATTCCCGGCAGAGTCCTCGTCGTTCTTTTTTTGGGAATCCTGATAGCATCAGGAATCCGTCTCGTCATCGATTTCGTGAATTCAACCGGTG GATACACTAGCGGAAGTACCATTGTTGACGTTATAGGTCATCAGGAAGTTGATGTTGCAAGTTTTACTGATCGTACCGTAGGGCGTGGAGTCAACTATGC TTCTGGCGCCAGAGGAGGAATTCTCAACGACACCGACAAGATGTTTGTAAATTGA
AA sequence Show only first row Show all	>Lus10037775 pacid=23167298 polypeptide=Lus10037775 locus=Lus10037775.g ID=Lus10037775.BGIv1.0 annot-version=v1.0 MGGIPGRVLVVLFLGILIASGIRLVIDFVNSTGGYTSGSTIVDVIGHQEVDVASFTDRTVGRGVNYASGARGGILNDTDKMFVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10037775 [exp]	0	1
AT5G24318			O-Glycosyl hydrolases family 1...		Lus10032038 [exp]	1.0	0.9199
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10028929 [exp]	8.6	0.9188
AT2G03350			Protein of unknown function, D...		Lus10037126 [exp]	10.6	0.9097
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10004348 [exp]	14.0	0.9076
					Lus10024349 [exp]	14.1	0.9116
AT1G08590			Leucine-rich receptor-like pro...		Lus10000814 [exp]	15.3	0.8910
AT1G70560		CKRC1, WEI8, TA...	WEAK ETHYLENE INSENSITIVE 8, S...		Lus10036846 [exp]	15.9	0.8719
AT5G40390		RS5, SIP1	seed imbibition 1-like, raffin...		Lus10027679 [exp]	18.5	0.9022
AT1G76240			Arabidopsis protein of unknown...		Lus10016005 [exp]	19.1	0.9024
AT3G63470		SCPL40	serine carboxypeptidase-like 4...		Lus10005327 [exp]	19.5	0.8974

Compare expression of checked genes

Lus10037775 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.