Lus10037791 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G47960 63 / 2e-12 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT5G64620 50 / 8e-08 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT3G17140 44 / 4e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017074 314 / 1e-110 AT3G17130 121 / 8e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10016319 191 / 4e-62 AT3G17130 151 / 8e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10002739 184 / 2e-59 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10003530 77 / 1e-17 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002933 74 / 1e-16 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 70 / 4e-15 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037792 68 / 3e-14 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017076 67 / 7e-14 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 66 / 1e-13 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G102600 159 / 6e-50 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.009G083500 91 / 7e-23 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.010G063000 74 / 2e-16 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.001G288500 52 / 5e-09 AT1G47960 59 / 1e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.007G108301 51 / 5e-08 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.008G013400 49 / 2e-07 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.005G007100 48 / 6e-07 AT1G09360 85 / 6e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.014G044100 47 / 2e-06 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G086600 42 / 7e-05 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.005G023050 42 / 0.0001 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10037791 pacid=23167156 polypeptide=Lus10037791 locus=Lus10037791.g ID=Lus10037791.BGIv1.0 annot-version=v1.0
ATGACAATCTCATTCCCTCGTACAATCCCTCTCCTATCACTAACAATTCTCTTCATCATCATTCCGACCGGCAGCGTCCAATCCGACGACGGTCAAAATC
TAATCGACCAAGTATGCAAGAAGACCCCTTTCTACCGCCTCTGTTCCGACACTCTGCATTATTCCGCCGCCAATAACACCACCTCAAAAGACGTCAAGGG
GATAGCTTCCGAGTTCACCCACGTCGTACTGTCGAACGCCACGGAGATGCTGGTTTACATCCAGGGACGGCTAAAGATCGCCGAGGATCCCAAGATGGAG
AAAGCTCTGGCGAATTGTGCGGAGCTCTACATTCCGGTGGTGAAGTACAATCTCCCTCAGGGGATCGACGCTTTCCTCAGGGGTTACTATGGCTTCACCA
GGTACGCGCTCTCCGACGCCGGAGATCAGGCCGACGCATGTGAGGGTAAATTCTCTGGCGGCGGAGGGGATGAGGTTAGTGCGAGGAGTAAGATGGTTAG
TGAGTTGTGTGATGTTGCGGCGGCGATTGTCGGATTGTTGATCAAAGGCCGCAGGGGTTTCTTGAATAATGTTTGA
AA sequence
>Lus10037791 pacid=23167156 polypeptide=Lus10037791 locus=Lus10037791.g ID=Lus10037791.BGIv1.0 annot-version=v1.0
MTISFPRTIPLLSLTILFIIIPTGSVQSDDGQNLIDQVCKKTPFYRLCSDTLHYSAANNTTSKDVKGIASEFTHVVLSNATEMLVYIQGRLKIAEDPKME
KALANCAELYIPVVKYNLPQGIDAFLRGYYGFTRYALSDAGDQADACEGKFSGGGGDEVSARSKMVSELCDVAAAIVGLLIKGRRGFLNNV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G17130 Plant invertase/pectin methyle... Lus10037791 0 1
AT3G12610 DRT100 DNA-DAMAGE REPAIR/TOLERATION 1... Lus10015700 6.9 0.8598
AT3G43720 Bifunctional inhibitor/lipid-t... Lus10026769 9.2 0.8132
AT3G20820 Leucine-rich repeat (LRR) fami... Lus10031824 13.1 0.7963
AT5G07010 ATST2A ARABIDOPSIS THALIANA SULFOTRAN... Lus10008673 16.8 0.8638
AT4G38840 SAUR-like auxin-responsive pro... Lus10010714 18.5 0.8163
AT4G38840 SAUR-like auxin-responsive pro... Lus10009623 22.2 0.8439
AT1G41830 SKS6 SKU5 SIMILAR 6, SKU5-similar 6... Lus10025107 27.5 0.7855
AT3G05100 S-adenosyl-L-methionine-depend... Lus10004147 28.3 0.7718
AT1G29430 SAUR-like auxin-responsive pro... Lus10025115 28.8 0.8562
AT3G43270 Plant invertase/pectin methyle... Lus10010170 29.7 0.7971

Lus10037791 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.