Lus10037792 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47960 91 / 9e-23 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT3G17140 62 / 1e-12 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17130 54 / 3e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17150 49 / 2e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17152 42 / 8e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017076 306 / 5e-108 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 118 / 9e-34 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017013 117 / 2e-33 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 110 / 1e-30 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 107 / 3e-29 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 105 / 9e-29 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017040 80 / 8e-19 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002738 72 / 9e-16 AT1G47960 67 / 5e-14 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10003530 68 / 2e-14 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G083500 97 / 1e-25 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.010G063000 97 / 2e-25 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.008G102600 76 / 2e-17 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G288500 55 / 4e-10 AT1G47960 59 / 1e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.007G108301 50 / 7e-08 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.010G209800 47 / 7e-07 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.005G023100 45 / 6e-06 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.005G023201 45 / 7e-06 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.004G016500 42 / 5e-05 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.005G023050 42 / 0.0001 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10037792 pacid=23167275 polypeptide=Lus10037792 locus=Lus10037792.g ID=Lus10037792.BGIv1.0 annot-version=v1.0
ATGGCGACTTCCACCGAACTCGTCACTCAACTTTCCGTCTTCTTCATATTTCTCTTCCTCTTCATAATCTCCGCAGAAGCCAATACTCCTCTCATAACGG
AAACCTGCAAGAAAACTCCCGACTACGACCTCTGCGTGTCCGTGCTCTCCACGCGGGCCGCCAAGGCCACCAGCGTGAAATCCCTGGCGCTAGCAATGGT
CCACGTGGTCGAGGCGAAAGCAAAAGCGACGTCGCTTCACATCAAGGAGCTGCTCAAAACGGCGTCGTCGTTGGCTAAAGAGTTAAAGGAGCCGCTCCAA
GCGTGTGATGGTAACTACGGGGTCATACTAGACTACGATGTCCCTGGAGCCGTGACGGAGGTGACGTACGGGAACCCGAAATTCGGGGTTGACTCGATGG
TGGACTCGGCGGGGGAGAGCGAGGATTGCGAGGGACAGTTTCGCGGCCGGAACGGTTCTGGTAAGTCGCCGTTGACGAGTAGGAACGAGGATGTCCGGCG
TGTGTCCCAGGTGGCGGCGGCTATCATCAGGAATATTGATGTCCGTTGA
AA sequence
>Lus10037792 pacid=23167275 polypeptide=Lus10037792 locus=Lus10037792.g ID=Lus10037792.BGIv1.0 annot-version=v1.0
MATSTELVTQLSVFFIFLFLFIISAEANTPLITETCKKTPDYDLCVSVLSTRAAKATSVKSLALAMVHVVEAKAKATSLHIKELLKTASSLAKELKEPLQ
ACDGNYGVILDYDVPGAVTEVTYGNPKFGVDSMVDSAGESEDCEGQFRGRNGSGKSPLTSRNEDVRRVSQVAAAIIRNIDVR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10037792 0 1
AT1G25220 WEI7, TRP4, ASB... WEAK ETHYLENE INSENSITIVE7, TR... Lus10013241 4.0 0.7685
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10017076 4.9 0.7949
AT4G19390 Uncharacterised protein family... Lus10018793 6.9 0.8084
AT4G32480 Protein of unknown function (D... Lus10041046 8.6 0.8111
AT5G41040 HXXXD-type acyl-transferase fa... Lus10035190 12.5 0.8061
AT5G51990 AP2_ERF CBF4, DREB1D DEHYDRATION-RESPONSIVE ELEMENT... Lus10019455 16.7 0.7552
Lus10034388 18.4 0.8087
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10041290 18.7 0.7195
AT5G48290 Heavy metal transport/detoxifi... Lus10025182 21.9 0.7951
Lus10011342 27.6 0.7878

Lus10037792 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.