Lus10037793 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G17152 74 / 4e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17150 66 / 5e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17220 60 / 4e-11 ATPMEI2 pectin methylesterase inhibitor 2 (.1)
AT1G47960 55 / 7e-09 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT5G64620 53 / 2e-08 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT3G17230 47 / 6e-06 invertase/pectin methylesterase inhibitor family protein (.1)
AT3G17130 41 / 0.0003 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17225 40 / 0.0006 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017077 266 / 7e-91 AT3G17152 76 / 1e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10017078 88 / 6e-21 AT5G49525 57 / 3e-12 unknown protein
Lus10016317 71 / 1e-14 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 66 / 3e-13 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 64 / 2e-12 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 64 / 2e-12 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10003530 59 / 3e-10 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002738 59 / 3e-10 AT1G47960 67 / 5e-14 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002933 56 / 2e-09 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G083500 67 / 1e-13 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.010G209800 67 / 2e-13 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.010G063000 61 / 2e-11 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.007G068300 52 / 3e-08 AT4G00872 113 / 4e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G127500 49 / 4e-07 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G148300 47 / 4e-07 AT5G49525 57 / 2e-12 unknown protein
Potri.013G012766 49 / 5e-07 ND /
Potri.003G122000 48 / 1e-06 AT5G64620 53 / 7e-09 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.013G012800 47 / 2e-06 ND /
Potri.002G191500 47 / 2e-06 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10037793 pacid=23167354 polypeptide=Lus10037793 locus=Lus10037793.g ID=Lus10037793.BGIv1.0 annot-version=v1.0
ATGCACAAGATTTCCACCCTCCTCCTCTTCTTCATCCCTCTCTTCCTTCACCAAGCTACGGCCGATGTGGCGCTGCTCGAAAAGACCTGCAAGAGCAGCA
CCAACTACAGACTCTGCATCTCATCCCTCCGATCGGATCCTCGAACCGCAAAGGCAGCCGATGTCAAAGGGCTGGCTTCGATCGAGTTGGACATCATCTC
GGCTAAGGCCAATGTCGCGTTAGACCACGTTGCTAGTCTGTTTAGGAACGTGACTGACCCGTATTTGTACCGTGCGTACGGGACCTGTGTCGAGGAGTTT
AGAGGAGCAGTCGAAGGTGCTAACTCCAGCCTCGCCGGTTCGATTTCTGGTTTGAAATCAGGGGATTATGCAGCGGCGAAGAGCGGGCTTGAGCGTACTA
AGGCCCATGTAGCGATGTGTCTGGAAGGGTTGGCTGGCGATAAGGGGCCGTTTACTGATGAGGCCCAACTCAAACGAATTGGATTTGGATCACAGAGTGC
ATCCACAGAAGATGAAGAAGTAGCAGAGCATCGTTACGAGAGCGACGGATTCAACCGCCGTCACCAAGCTCCACAGCACCTCGTCGATCGAGAACTCCAG
CCACCGCAGGCTAGGCTGGCTCCACCGCCGCCACGAGAGGTCGATGCCAGGCCATCGGAAGCTAGATGTCGGCAGGGAGAGGTCGAGTTCCGGCCACCGG
AAGTAGGATGGGTACCAGTACACCCACCACCGGCACATAATGAGGAATTTTGA
AA sequence
>Lus10037793 pacid=23167354 polypeptide=Lus10037793 locus=Lus10037793.g ID=Lus10037793.BGIv1.0 annot-version=v1.0
MHKISTLLLFFIPLFLHQATADVALLEKTCKSSTNYRLCISSLRSDPRTAKAADVKGLASIELDIISAKANVALDHVASLFRNVTDPYLYRAYGTCVEEF
RGAVEGANSSLAGSISGLKSGDYAAAKSGLERTKAHVAMCLEGLAGDKGPFTDEAQLKRIGFGSQSASTEDEEVAEHRYESDGFNRRHQAPQHLVDRELQ
PPQARLAPPPPREVDARPSEARCRQGEVEFRPPEVGWVPVHPPPAHNEEF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G17152 Plant invertase/pectin methyle... Lus10037793 0 1
AT3G04070 NAC ANAC047 NAC domain containing protein ... Lus10003269 1.7 0.9622
AT5G22050 Protein kinase superfamily pro... Lus10004110 2.8 0.9384
AT5G53050 alpha/beta-Hydrolases superfam... Lus10022392 4.2 0.9404
AT5G05130 DNA/RNA helicase protein (.1) Lus10027296 5.3 0.9569
AT4G19420 Pectinacetylesterase family pr... Lus10035682 7.7 0.9356
AT4G19420 Pectinacetylesterase family pr... Lus10037269 8.4 0.9336
AT5G67090 Subtilisin-like serine endopep... Lus10024815 9.5 0.9251
AT5G57500 Galactosyltransferase family p... Lus10000372 14.3 0.9252
AT4G27790 Calcium-binding EF hand family... Lus10022381 16.0 0.8925
AT1G10800 unknown protein Lus10037441 17.9 0.9239

Lus10037793 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.