Lus10037796 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 405 / 4e-141 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 379 / 4e-131 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06650 377 / 3e-130 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G59530 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30840 373 / 1e-128 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G04350 367 / 3e-126 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06640 358 / 1e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT2G30830 357 / 1e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G03410 358 / 2e-122 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G43450 355 / 1e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017080 655 / 0 AT1G06620 440 / 3e-155 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 494 / 5e-176 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022197 453 / 3e-160 AT1G06620 434 / 6e-153 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 447 / 1e-157 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 440 / 6e-155 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022191 437 / 7e-154 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022415 437 / 2e-153 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022196 433 / 3e-152 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027586 432 / 5e-152 AT1G06620 449 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G073232 419 / 1e-146 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 417 / 7e-146 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073166 414 / 6e-145 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.008G165400 373 / 2e-128 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 361 / 5e-124 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.011G156200 360 / 1e-123 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.013G045000 331 / 5e-112 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 324 / 2e-109 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.002G040700 313 / 7e-105 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 313 / 7e-105 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10037796 pacid=23167292 polypeptide=Lus10037796 locus=Lus10037796.g ID=Lus10037796.BGIv1.0 annot-version=v1.0
ATGGACTCTGCCACTGATCGACTCTCCCAGCTGAAAGCCTTCGACGAAACAAAAGCCGGCGTCAAAGGCCTTGCGGACGCCGGAATCAAACAACTCCCCG
GATTCTTTCTCGCGCCGCCGCATTTCCTCGACAACGGAACCCACAGCGACGATCCAAACGACTTCGTTGTCCCAACCATTGACCTGCAGGGAGGAGGAGG
CGGCGATCGGAAACAGGTTGTCGATAGAATCAGGGAGGCATCCGAGAAATGGGGATTCTTCCAAGTGGTGAACCATGGTATTGCGGAGAGCGTACTAGAG
GAGATGAAAGCCGGAGTGCGGAGGTTCCACGAACAGGATTTGGAGATGAAGAAAGAGTTTTTTGGGAGGGATCCTACCAAGACTGTTGTTTACAACAGCA
ATTACGATTTGTATACTACGCCCGTTGTCAACTGGAGGGATACCGTTCTGTTTCATATGGCTCCGGATGCTCCGAATCCTGACGAATTGCCCTCTTCGTG
CAGGGAAATTGTGATGGAATACAGCAAGGAATTGCTGAAATTATCATATCTACTGTTCCAACTGTTATCAGAAGCTTTGGGTTTACCATCAGATTACTTG
AAAGAAATGGATTGTGCAAAAGGGATATACATGGCGTGCCATTACCATCCACCTTGCCCTCAGCCAGAGCTTACGCTCGGAGCAACAAAGCATACCGACT
TCGATTTCATCACGGTGCTGTTACAGGACCACATCGGAGGCCTTCAGGTTCTCCATCGAGGGCGGTGGGTGGATGTCCCGCCTTTGCAAGGAGGTCTAGT
GGTCAACATCGGAGATTTGCTCCAGCTGATGACCAACGACAAGTTCGTAAGTGTGAACCATAGAGTGGTGAGTAAGAGTGTCGGACCGAGAATATCGATA
GCGTCGTTTTTTAGCACCGGATTTGCTGTGAATGATAGGCTGTACGGACCGATAAAGGAGTTGGTATCGGCGGATGATCCTCCGAGATACAAGGAAACTA
CGATTCAAGATTACACAAACCAGGCTTATAAGAAGGGATTGGATGGGACCTCTGCATTGTTGAATTTTAAGATCTGA
AA sequence
>Lus10037796 pacid=23167292 polypeptide=Lus10037796 locus=Lus10037796.g ID=Lus10037796.BGIv1.0 annot-version=v1.0
MDSATDRLSQLKAFDETKAGVKGLADAGIKQLPGFFLAPPHFLDNGTHSDDPNDFVVPTIDLQGGGGGDRKQVVDRIREASEKWGFFQVVNHGIAESVLE
EMKAGVRRFHEQDLEMKKEFFGRDPTKTVVYNSNYDLYTTPVVNWRDTVLFHMAPDAPNPDELPSSCREIVMEYSKELLKLSYLLFQLLSEALGLPSDYL
KEMDCAKGIYMACHYHPPCPQPELTLGATKHTDFDFITVLLQDHIGGLQVLHRGRWVDVPPLQGGLVVNIGDLLQLMTNDKFVSVNHRVVSKSVGPRISI
ASFFSTGFAVNDRLYGPIKELVSADDPPRYKETTIQDYTNQAYKKGLDGTSALLNFKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10037796 0 1
AT5G44410 FAD-binding Berberine family p... Lus10042383 2.4 0.6602
AT5G60740 ABCG28 ATP-binding cassette G28, ABC ... Lus10021448 9.8 0.6657
AT2G43610 Chitinase family protein (.1) Lus10003584 10.3 0.6660
AT3G19300 Protein kinase superfamily pro... Lus10034770 14.8 0.6443
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10027947 20.4 0.6201
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10013764 22.3 0.5079
AT3G59500 Integral membrane HRF1 family ... Lus10008752 22.8 0.5847
AT4G21690 ATGA3OX3 ARABIDOPSIS THALIANA GIBBERELL... Lus10013134 25.7 0.5865
AT1G75130 CYP721A1 "cytochrome P450, family 721, ... Lus10010799 27.4 0.5744
AT2G31083 AtCLE5, CLE5, C... CLAVATA3/ESR-RELATED 5 (.1) Lus10002196 31.3 0.5729

Lus10037796 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.