Lus10037798 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13770 125 / 2e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G37170 105 / 3e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G68930 101 / 1e-25 pentatricopeptide (PPR) repeat-containing protein (.1)
AT3G22690 101 / 1e-25 unknown protein
AT3G02010 101 / 2e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53360 100 / 2e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G03380 100 / 3e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G33170 100 / 5e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G18520 99 / 9e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G33760 99 / 1e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017082 281 / 3e-90 AT1G16480 507 / 3e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10040504 118 / 2e-31 AT3G13770 904 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013991 117 / 5e-31 AT3G57430 632 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015414 113 / 1e-29 AT3G57430 629 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10039117 104 / 1e-26 AT3G24000 740 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10009437 104 / 1e-26 AT1G71420 753 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10021232 103 / 2e-26 AT2G33680 818 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10029482 102 / 8e-26 AT4G18520 624 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10014594 102 / 8e-26 AT3G02330 901 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G067500 201 / 9e-61 AT4G13650 590 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G051300 124 / 9e-34 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G161800 107 / 1e-27 AT2G03380 786 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G047800 106 / 2e-27 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G111300 104 / 1e-26 AT3G02330 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G164900 103 / 2e-26 AT5G13230 950 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G208000 102 / 4e-26 AT2G03880 939 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G006800 101 / 1e-25 AT2G33680 780 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.017G091600 100 / 4e-25 AT4G37170 924 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G083700 100 / 5e-25 AT3G22690 1050 / 0.0 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10037798 pacid=23166992 polypeptide=Lus10037798 locus=Lus10037798.g ID=Lus10037798.BGIv1.0 annot-version=v1.0
ATGCTTCGACAATGCACTTCCAAACTGGCCCTAAACGACGGGAGGGCGGTTCATGGGAATCTCATAAGGAGTGGGGTTGTGCCTGATTCACATTTATGGG
TTTCTTTAACTAATTTCTATGCCAAGTGTGATTGTCTCCACATAGCACGCCAAGTGCTCGATGAAACGCCTGAACGTGGTGTTGTGTCGTGGACGGCTTT
AGTTTCTGGGTTTGTCAGTAAAGGGTGCGGAGACGATGCTGCTAATCTATATTGCGTGATGAGGAGTGAAGACGTGAGGCCCAATGAGTATCTATTGGCT
ACTATATTGAAAGCTTGCTCTCTATGCTTGGACGTGGAGCTTGGGAAGCAAGTACACGCCGATGCAGTAAAGGTTGGCTTGTTAAGGGACTTGTTTGTTG
CCTCTGGTCTTGTGGATTTTTATGCTAAATGCAATTAA
AA sequence
>Lus10037798 pacid=23166992 polypeptide=Lus10037798 locus=Lus10037798.g ID=Lus10037798.BGIv1.0 annot-version=v1.0
MLRQCTSKLALNDGRAVHGNLIRSGVVPDSHLWVSLTNFYAKCDCLHIARQVLDETPERGVVSWTALVSGFVSKGCGDDAANLYCVMRSEDVRPNEYLLA
TILKACSLCLDVELGKQVHADAVKVGLLRDLFVASGLVDFYAKCN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G13770 Pentatricopeptide repeat (PPR)... Lus10037798 0 1
AT1G68930 pentatricopeptide (PPR) repeat... Lus10037799 8.8 0.8191
AT2G22410 SLO1 SLOW GROWTH 1 (.1) Lus10002552 10.7 0.8475
AT1G16480 Tetratricopeptide repeat (TPR)... Lus10017082 11.5 0.8443
AT2G40720 Tetratricopeptide repeat (TPR)... Lus10012873 13.3 0.8397
AT2G40720 Tetratricopeptide repeat (TPR)... Lus10030522 21.0 0.8325
AT5G60040 NRPC1 nuclear RNA polymerase C1 (.1.... Lus10000051 27.7 0.8088
AT5G40520 unknown protein Lus10027029 31.7 0.8221
AT1G64600 methyltransferases;copper ion ... Lus10017311 40.6 0.7061
AT1G56690 Pentatricopeptide repeat (PPR)... Lus10013149 42.4 0.8077
AT4G30150 unknown protein Lus10007572 53.6 0.8151

Lus10037798 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.