Lus10037800 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017083 37 / 0.0004 ND 35 / 0.010
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10037800 pacid=23167098 polypeptide=Lus10037800 locus=Lus10037800.g ID=Lus10037800.BGIv1.0 annot-version=v1.0
ATGAAGAGGATCATACTAAGCGCGCGGCCAAACAATACTGGTGCCTTCGCGAAGCCTGAACTCCTCAAAGCAAGCAGTCCGCCACCTGAAAAAATAGGTG
CACGGTTGTTGATGCTCAGCAGTTTCAAGAATCTGCAAGTGGCCGTGTCAAACTGTAAACCTGATTGGTTTTTGGCCGAGCATGGTAAACACTGTTTCCT
ATCTCAACAGACTAACTTTCTGATATCCGCCCCGGCTTCTGGTTCACCGAATTGTAGCCATGGAGTTGAGTTGCGATGA
AA sequence
>Lus10037800 pacid=23167098 polypeptide=Lus10037800 locus=Lus10037800.g ID=Lus10037800.BGIv1.0 annot-version=v1.0
MKRIILSARPNNTGAFAKPELLKASSPPPEKIGARLLMLSSFKNLQVAVSNCKPDWFLAEHGKHCFLSQQTNFLISAPASGSPNCSHGVELR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10037800 0 1
AT5G34940 ATGUS3 glucuronidase 3 (.1.2.3) Lus10001952 1.0 0.7665
AT1G44110 CYCA1;1 Cyclin A1;1 (.1) Lus10014199 4.7 0.6691
AT1G18090 5'-3' exonuclease family prote... Lus10038958 6.0 0.7476
Lus10018751 11.7 0.7026
AT3G61650 TUBG1 gamma-tubulin (.1) Lus10010985 16.1 0.6912
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10014044 21.5 0.7283
AT3G09430 unknown protein Lus10000245 25.2 0.6898
AT1G56350 Peptide chain release factor 2... Lus10010922 29.0 0.6410
Lus10000761 36.3 0.5868
AT5G42630 GARP KAN4, KANADI4, ... KANADI 4, ABERRANT TESTA SHAPE... Lus10011660 36.9 0.6676

Lus10037800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.