Lus10037819 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G49230 169 / 5e-53 HRB1 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
AT3G06760 169 / 2e-52 Drought-responsive family protein (.1.2)
AT3G05700 136 / 5e-40 Drought-responsive family protein (.1)
AT5G26990 130 / 2e-37 Drought-responsive family protein (.1)
AT1G56280 127 / 2e-36 ATDI19 drought-induced 19 (.1.2)
AT4G02200 113 / 6e-31 Drought-responsive family protein (.1.2.3)
AT1G02750 99 / 3e-25 Drought-responsive family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017097 274 / 2e-94 AT5G49230 131 / 2e-38 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Lus10031467 154 / 1e-46 AT5G26990 253 / 1e-85 Drought-responsive family protein (.1)
Lus10037717 137 / 4e-37 AT4G16100 321 / 2e-103 Protein of unknown function (DUF789) (.1)
Lus10013420 116 / 6e-32 AT3G06760 124 / 3e-35 Drought-responsive family protein (.1.2)
Lus10001462 103 / 7e-27 AT3G05700 124 / 5e-35 Drought-responsive family protein (.1)
Lus10015214 100 / 2e-26 AT5G26990 194 / 5e-63 Drought-responsive family protein (.1)
Lus10010305 100 / 1e-25 AT3G06760 108 / 5e-29 Drought-responsive family protein (.1.2)
Lus10002441 79 / 5e-19 AT5G26990 95 / 3e-25 Drought-responsive family protein (.1)
Lus10015412 82 / 8e-19 AT5G26990 123 / 1e-34 Drought-responsive family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G000800 211 / 2e-69 AT5G49230 190 / 5e-61 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.008G213400 201 / 2e-65 AT5G49230 196 / 2e-63 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.013G011200 169 / 1e-52 AT3G05700 250 / 1e-84 Drought-responsive family protein (.1)
Potri.005G020900 168 / 2e-52 AT3G05700 224 / 3e-74 Drought-responsive family protein (.1)
Potri.002G200500 129 / 4e-37 AT3G05700 152 / 7e-46 Drought-responsive family protein (.1)
Potri.019G027300 116 / 1e-33 AT5G49230 123 / 1e-36 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Potri.014G125500 117 / 2e-32 AT3G05700 148 / 2e-44 Drought-responsive family protein (.1)
Potri.011G057200 84 / 1e-19 AT3G06760 110 / 2e-29 Drought-responsive family protein (.1.2)
Potri.012G086500 79 / 4e-18 AT1G56280 92 / 6e-23 drought-induced 19 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF05605 zf-Di19 Drought induced 19 protein (Di19), zinc-binding
Representative CDS sequence
>Lus10037819 pacid=23167060 polypeptide=Lus10037819 locus=Lus10037819.g ID=Lus10037819.BGIv1.0 annot-version=v1.0
ATGGCTTCCGACCCCTGGGGCTCTCGCTTCTCCACTTCTTCATCTCGACGTCACCAAGTTCGGCCTGGTTCAGATCTATTTGAAGATGAAAGGGAATTGG
AAGATGATCCCAAAGCCGAGTTCTTGTGTCCCTTTTGTGCCGAGGATTTTGATGTTCTGGGACTTTGTTGTCATATGGACGTGGAGCATCCTGTTGAGAC
AAAAAATGGGGTGTGCCCTGTCTGCGCTAAAAGAGTGGGATTGGATATCGTTGGCCATATTACTACGCAGCATCAGAGTTTATTTAAGATATCCCGTAAG
AGACGATTGCGTAAAGGTGGACCTAACTCGACATTCTCTTCACTATTGAAGAAAGAACTCCGCGATGGCAGCTTACAGTCACTCCTCGGGGGTTCTTCCT
ATGTCTCCAGTACAGAGCCTGATCCGCTGCTTTCATCATTCATGTTTAGTCCGTCTGGACATGATGAGCCTCCGAGTGTTCTCCGTGCTGCTTCAGTTGA
AACAAGTCCAGCAGTGGATGATAGCATGATCAATGCATCTGTAATTAGGGAAATTGAGCCATCAGCGCCTGTATCAGAGAAGGAAACAGAAGAGAAGTCT
CGGAGGTGCGAGTTTGTTCGAGGACTGGTGCTATCCACCATTCTTGATGAGTTATGA
AA sequence
>Lus10037819 pacid=23167060 polypeptide=Lus10037819 locus=Lus10037819.g ID=Lus10037819.BGIv1.0 annot-version=v1.0
MASDPWGSRFSTSSSRRHQVRPGSDLFEDERELEDDPKAEFLCPFCAEDFDVLGLCCHMDVEHPVETKNGVCPVCAKRVGLDIVGHITTQHQSLFKISRK
RRLRKGGPNSTFSSLLKKELRDGSLQSLLGGSSYVSSTEPDPLLSSFMFSPSGHDEPPSVLRAASVETSPAVDDSMINASVIREIEPSAPVSEKETEEKS
RRCEFVRGLVLSTILDEL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G49230 HRB1 HYPERSENSITIVE TO RED AND BLUE... Lus10037819 0 1
AT5G49230 HRB1 HYPERSENSITIVE TO RED AND BLUE... Lus10017097 1.0 0.9414
AT4G16100 Protein of unknown function (D... Lus10037717 2.0 0.9147
AT1G21840 UREF urease accessory protein F (.1... Lus10027319 4.9 0.8725
AT1G73500 ATMKK9 MAP kinase kinase 9 (.1) Lus10001081 12.5 0.8557
AT1G27000 Protein of unknown function (D... Lus10036718 13.4 0.8749
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10020016 13.8 0.8597
AT1G21770 Acyl-CoA N-acyltransferases (N... Lus10025670 14.1 0.8796
AT4G11660 HSF AT-HSFB2B, HSFB... HEAT SHOCK TRANSCRIPTION FACTO... Lus10038874 15.5 0.8446
AT2G45620 Nucleotidyltransferase family ... Lus10009310 18.4 0.8369
AT3G10760 GARP Homeodomain-like superfamily p... Lus10012102 18.5 0.8112

Lus10037819 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.