Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17300 156 / 2e-51 EMB2786 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017110 [exp] 186 / 5e-62 AT3G17300 156 / 4e-50 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G152100 [exp] 166 / 4e-55 AT3G17300 156 / 2e-51 unknown protein Potri.008G100400 [exp] 161 / 2e-53 AT3G17300 151 / 2e-49 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037835 pacid=23167227 polypeptide=Lus10037835 locus=Lus10037835.g ID=Lus10037835.BGIv1.0 annot-version=v1.0 ATGCCGTCTCTGCAAACTGCATTGCCGCCCGAATTGGCCAACAACGCTATCCGACTATACCGGGAATGTCTTCGAAGAGCTAAGTACGTCGGTCATCAGC AACACAACACAGCTTTGTTGGTGGATATGGTGAGGCAGCAGTTCAAAAGGCACAAGAACGAGACCGACCCTGACAAGATTCAAAAGTTAAAGGACGATGC GGCAAGAGGGCTTATAAACCACATGCTCTACGAATCTGAGAAGTCGTCTGGTCGTAAGTTCAGCAAGAGGCCCACTTAA
AA sequence Show only first row Show all	>Lus10037835 pacid=23167227 polypeptide=Lus10037835 locus=Lus10037835.g ID=Lus10037835.BGIv1.0 annot-version=v1.0 MPSLQTALPPELANNAIRLYRECLRRAKYVGHQQHNTALLVDMVRQQFKRHKNETDPDKIQKLKDDAARGLINHMLYESEKSSGRKFSKRPT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G17300		EMB2786	unknown protein		Lus10037835 [exp]	0	1
AT5G30490			unknown protein		Lus10037824 [exp]	4.5	0.9111
AT4G28360			Ribosomal protein L22p/L17e fa...		Lus10037603 [exp]	4.6	0.9192
AT5G48870		SAD1	SUPERSENSITIVE TO ABA AND DROU...		Lus10011877 [exp]	5.5	0.9052
AT2G46230			PIN domain-like family protein...		Lus10010134 [exp]	5.5	0.9200
AT5G38720			unknown protein		Lus10023232 [exp]	5.7	0.9047
AT4G21585		ENDO4	endonuclease 4 (.1)		Lus10018451 [exp]	6.7	0.8880
AT5G26800			unknown protein		Lus10011180 [exp]	6.9	0.9129
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Lus10035650 [exp]	6.9	0.9223
AT5G23535			KOW domain-containing protein ...		Lus10022069 [exp]	8.2	0.9191
AT5G18540			unknown protein		Lus10002878 [exp]	9.2	0.8943

Compare expression of checked genes

Lus10037835 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.