Lus10037848 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15570 293 / 6e-96 Phototropic-responsive NPH3 family protein (.1)
AT1G52770 272 / 1e-87 Phototropic-responsive NPH3 family protein (.1)
AT5G64330 165 / 5e-45 JK218, RPT3, NPH3 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
AT5G03250 135 / 4e-35 Phototropic-responsive NPH3 family protein (.1)
AT5G13600 134 / 2e-34 Phototropic-responsive NPH3 family protein (.1)
AT1G30440 134 / 3e-34 Phototropic-responsive NPH3 family protein (.1)
AT2G14820 132 / 8e-34 MEL3, NPY2 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1)
AT5G67385 132 / 8e-34 Phototropic-responsive NPH3 family protein (.1)
AT5G48800 130 / 2e-33 Phototropic-responsive NPH3 family protein (.1)
AT1G03010 126 / 1e-31 Phototropic-responsive NPH3 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030390 428 / 9e-150 AT3G15570 241 / 2e-75 Phototropic-responsive NPH3 family protein (.1)
Lus10014337 144 / 6e-38 AT5G10250 620 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Lus10013799 141 / 7e-37 AT5G03250 672 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10038531 140 / 1e-36 AT1G30440 915 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10026046 138 / 1e-35 AT5G10250 639 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Lus10025928 137 / 1e-35 AT5G48800 925 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10033796 137 / 2e-35 AT2G14820 735 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1)
Lus10009292 134 / 1e-34 AT5G03250 670 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Lus10040409 134 / 2e-34 AT5G03250 667 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G058800 301 / 3e-99 AT3G15570 499 / 1e-175 Phototropic-responsive NPH3 family protein (.1)
Potri.001G175400 285 / 6e-93 AT1G52770 507 / 8e-179 Phototropic-responsive NPH3 family protein (.1)
Potri.007G112600 168 / 2e-46 AT5G64330 989 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
Potri.017G048200 166 / 1e-45 AT5G64330 993 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2)
Potri.010G223600 150 / 4e-40 AT5G03250 683 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.008G038600 149 / 1e-39 AT5G03250 723 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.005G075400 147 / 7e-39 AT5G10250 695 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 3, Phototropic-responsive NPH3 family protein (.1)
Potri.011G091100 144 / 4e-38 AT1G30440 924 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.016G139900 142 / 2e-37 AT3G08570 723 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Potri.001G357100 142 / 3e-37 AT1G30440 971 / 0.0 Phototropic-responsive NPH3 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03000 NPH3 NPH3 family
Representative CDS sequence
>Lus10037848 pacid=23163703 polypeptide=Lus10037848 locus=Lus10037848.g ID=Lus10037848.BGIv1.0 annot-version=v1.0
ATGACGTCATCGCTGATGAAGAAAAGATTCTTCGTGGAGACGCTGGTGGGGATTCTCCCGGGGGAGAGAGACTCGGTGCCTTGCAATTTCTTACTGCGGC
TGCTCCGTACGGCTAACATGGTGGGAGCCGAGCCGGGGTGCGTAGCCGAGCTGGAGGCGAGGGCGGCGCGGCAGGCGGCCGGCCCGCTGGTGGGGGGGAA
GGAGCTGATGATTCCTTCGTTTAGCAATTACACGTGCGGGAGCACGGTGCTCGACGTGGAGCTCGCGACTCGGCTGGTGAAGATGTGTGTCGGTAGTAAG
GCGGCGGCGGAGGCGGCGGGGAAAGTGGGGAAGCTGGTGTATGGGTACCTGGCGGAGGTGGCGGTGGATCCGAACCTGGGGCTTTTGGAGTTTGTGTCTC
TTGCTGCAGCGGTTCCTCACCATGCCCGTACGATCGACGATGGGCTCTACCGTGCTATCGATACTTATCTCAAAGCACATCCAGGGGTGTCAAAGCATGA
GAGGAAGAGCCTGTGCAGGCTAATAGACAGCAGGAAGCTCTCACCAGAGGCATCCTACCACGCTTCCCACAACGAAAGGCTACCGGTTCGAGTCGTGATC
CAAGTCCTCTTCGCCGAGCAAACCAAGCTCACAAGGCAACTCGACTGGAGCAGCGGCTCCTTCAACAACGACCTAAACCTCATGACTCGTTCGAGCCCCA
ACCCTCGGTCTTACAACAACAACAACATGGACCATCAAGACCCATCGACCCGATGCCACTCGAAGCGGGAGGTGAACGCGCAGAATTCGGAGATCAGGAA
GCTGAAGGAAGACGTGGTGAGGCTGCAGAGCCAGTGCCTCAGCATGCAGAGCCAGATGGGGAGGCTGATGGCTGACCAGAAGAAGAAAAACAACGGTGGG
CATCATCATGTGTTTAGCTACTGGAAGAAGTTAGGGTTCTCATCAACAACTTTCAAAGCTAACTCAAGTGATCAGATGAAGGTGGTTGATCAATTGAATG
AAGGATTGAGATCAGATCATCATGGAGAAGTTGTTATGGGAAAGGAAACTCCAGTTGTTGACAATATCAAGGCCAAACTTGTCAAGAAGAGGACTCCTCC
TCACAGGTGGAGAAAATCCATGTCTTGA
AA sequence
>Lus10037848 pacid=23163703 polypeptide=Lus10037848 locus=Lus10037848.g ID=Lus10037848.BGIv1.0 annot-version=v1.0
MTSSLMKKRFFVETLVGILPGERDSVPCNFLLRLLRTANMVGAEPGCVAELEARAARQAAGPLVGGKELMIPSFSNYTCGSTVLDVELATRLVKMCVGSK
AAAEAAGKVGKLVYGYLAEVAVDPNLGLLEFVSLAAAVPHHARTIDDGLYRAIDTYLKAHPGVSKHERKSLCRLIDSRKLSPEASYHASHNERLPVRVVI
QVLFAEQTKLTRQLDWSSGSFNNDLNLMTRSSPNPRSYNNNNMDHQDPSTRCHSKREVNAQNSEIRKLKEDVVRLQSQCLSMQSQMGRLMADQKKKNNGG
HHHVFSYWKKLGFSSTTFKANSSDQMKVVDQLNEGLRSDHHGEVVMGKETPVVDNIKAKLVKKRTPPHRWRKSMS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15570 Phototropic-responsive NPH3 fa... Lus10037848 0 1
AT2G02070 C2H2ZnF ATIDD5 indeterminate(ID)-domain 5 (.1... Lus10031929 2.4 0.7431
AT5G09650 ATPPA6 pyrophosphorylase 6 (.1) Lus10037239 12.7 0.7172
AT5G12080 ATMSL10, MSL10 mechanosensitive channel of sm... Lus10002960 14.8 0.7419
AT5G12080 ATMSL10, MSL10 mechanosensitive channel of sm... Lus10006347 14.9 0.7719
AT3G10520 ATGLB2, ARATHGL... NON-SYMBIOTIC HAEMOGLOBIN 2, A... Lus10037926 16.7 0.7112
AT5G63310 NDPK1A, NDPKIAI... NDP KINASE 1A, NUCLEOSIDE DIPH... Lus10014787 22.4 0.7422
AT4G18910 ATNLM2, NIP1;2,... NOD26-LIKE INTRINSIC PROTEIN 2... Lus10029274 23.2 0.7342
AT1G17650 GR2, GLYR2 glyoxylate reductase 2 (.1) Lus10015612 39.6 0.6829
AT2G02410 unknown protein Lus10042400 40.6 0.7342
AT1G59960 NAD(P)-linked oxidoreductase s... Lus10010720 42.7 0.6871

Lus10037848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.