Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00530 91 / 2e-26 unknown protein AT1G01725 70 / 6e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G082800 [exp] 95 / 5e-28 AT4G00530 102 / 6e-31 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037854 pacid=23163864 polypeptide=Lus10037854 locus=Lus10037854.g ID=Lus10037854.BGIv1.0 annot-version=v1.0 ATGAATCCCAATTTGGACAAGATAGTGAGAAGGACAACAATGGTGTCAACAGTCGTCGCTTCTTATTTCCTCTTAACCGCTGACTACGGTCCCGAACCGA ATGTTCTTGATCCAGTTAAGAAGGCTATACGATCTGCAGAGAACTCGATGAAAGAGTTCTTCGTTGGATCAAAGAGAGACTCTTGA
AA sequence Show only first row Show all	>Lus10037854 pacid=23163864 polypeptide=Lus10037854 locus=Lus10037854.g ID=Lus10037854.BGIv1.0 annot-version=v1.0 MNPNLDKIVRRTTMVSTVVASYFLLTADYGPEPNVLDPVKKAIRSAENSMKEFFVGSKRDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G00530			unknown protein		Lus10037854 [exp]	0	1
AT3G06610			DNA-binding enhancer protein-r...		Lus10037773 [exp]	1.0	0.9029
AT2G42680		MBF1A, ATMBF1A	ARABIDOPSIS THALIANA MULTIPROT...		Lus10000056 [exp]	5.7	0.8741
AT1G07960		ATPDIL5-1	PDI-like 5-1 (.1.2.3)		Lus10036125 [exp]	6.0	0.8580
AT5G06240		EMB2735	embryo defective 2735 (.1)		Lus10021327 [exp]	7.1	0.8103
AT5G65270		AtRABA4a	RAB GTPase homolog A4A (.1)		Lus10035924 [exp]	8.9	0.8436
AT1G11760		MED32	unknown protein		Lus10034758 [exp]	9.5	0.8436
AT1G04290			Thioesterase superfamily prote...		Lus10004288 [exp]	10.5	0.8553
AT1G15270			Translation machinery associat...		Lus10037543 [exp]	11.6	0.8624
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Lus10023313 [exp]	13.7	0.8323
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10038835 [exp]	14.5	0.8357

Compare expression of checked genes

Lus10037854 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.