Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01730 74 / 2e-17 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030384 [exp] 197 / 5e-66 AT1G01730 109 / 8e-30 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G158500 [exp] 95 / 2e-25 AT1G01730 77 / 3e-17 unknown protein Potri.014G082600 [exp] 92 / 2e-23 AT1G01730 84 / 1e-18 unknown protein Potri.015G145000 [exp] 65 / 3e-14 AT1G01730 48 / 8e-07 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037855 pacid=23163630 polypeptide=Lus10037855 locus=Lus10037855.g ID=Lus10037855.BGIv1.0 annot-version=v1.0 ATGTATGTTATCGTGAAGGTTATTCGAACGGCTGATTTCAGGAGCTGCAAAGGAGCTCATGAAATTCGAGAAAAGCTGAAGGTGGTGATGGAACTATGCA AACAGTTGACTGCAGAGACTGGTGGGAATGCCAAGTCTAGATTTGCAGCAGAAGGCGAAAATGGCAGCGGGCAAAAGATCGTCGGAGCCTCCGCCTTTGG CTGGAACTTCATTACTTATCCTGACAGTGGCGGTGAACCAGTCTACTACGGAAGAACAAAGGAATCGTTTCGAGCTGCTGCATCACTATCGGTCGAAACA TCAGGTGTCTAA
AA sequence Show only first row Show all	>Lus10037855 pacid=23163630 polypeptide=Lus10037855 locus=Lus10037855.g ID=Lus10037855.BGIv1.0 annot-version=v1.0 MYVIVKVIRTADFRSCKGAHEIREKLKVVMELCKQLTAETGGNAKSRFAAEGENGSGQKIVGASAFGWNFITYPDSGGEPVYYGRTKESFRAAASLSVET SGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01730			unknown protein		Lus10037855 [exp]	0	1
AT2G14255			Ankyrin repeat family protein ...		Lus10012455 [exp]	16.9	0.7876
AT3G07740		HXA2, HXA02, HA...	homolog of yeast ADA2 2A (.1.2...		Lus10006383 [exp]	20.8	0.7712
AT3G25840			Protein kinase superfamily pro...		Lus10035032 [exp]	23.1	0.7657
AT1G47570			RING/U-box superfamily protein...		Lus10033472 [exp]	25.8	0.7620
AT5G47900			Protein of unknown function (D...		Lus10036333 [exp]	36.2	0.7602
AT4G36280			Histidine kinase-, DNA gyrase ...		Lus10025978 [exp]	52.1	0.7337
AT5G22620			phosphoglycerate/bisphosphogly...		Lus10009404 [exp]	59.6	0.7447
AT4G10970			unknown protein		Lus10032393 [exp]	67.1	0.7386
AT1G77800			PHD finger family protein (.1....		Lus10009786 [exp]	72.7	0.7158
AT2G04880	WRKY	ATWRKY1, ZAP1	zinc-dependent activator prote...		Lus10012322 [exp]	93.4	0.6948

Compare expression of checked genes

Lus10037855 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.