Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45860 35 / 0.0008 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10037857 pacid=23163694 polypeptide=Lus10037857 locus=Lus10037857.g ID=Lus10037857.BGIv1.0 annot-version=v1.0 ATGTCGAAGAAGAACAATTTGGCCAAGAGAAAGAAGCAGCACGAATTCGATCTGAAAAGAGAGAAGGAGGAGAGGGAGAAGCAACAGAAGAAGCTTCAAG CAAAGAAGAACAAGATGAAAGTTGATGGTAGTGGGAAGAAGAAGAAAGGAAGTGGAGGGTTTCAAGTTGGGAAGAGGAAGTTGAAGATGAAGGCCAAGTT GTCTGCTACTGCAAAAGCTAAAGCTGCTCAAGCCATGGAGCTTGACATGTAG
AA sequence Show only first row Show all	>Lus10037857 pacid=23163694 polypeptide=Lus10037857 locus=Lus10037857.g ID=Lus10037857.BGIv1.0 annot-version=v1.0 MSKKNNLAKRKKQHEFDLKREKEEREKQQKKLQAKKNKMKVDGSGKKKKGSGGFQVGKRKLKMKAKLSATAKAKAAQAMELDM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45860			unknown protein		Lus10037857 [exp]	0	1
AT1G18440			Peptidyl-tRNA hydrolase family...		Lus10032480 [exp]	8.9	0.8127
AT2G04630		NRPE6B, NRPB6B	RNA polymerase Rpb6 (.1)		Lus10015000 [exp]	9.4	0.8601
AT5G56670			Ribosomal protein S30 family p...		Lus10017473 [exp]	11.1	0.8492
AT3G25210			Tetratricopeptide repeat (TPR)...		Lus10038215 [exp]	12.8	0.8343
AT3G11500			Small nuclear ribonucleoprotei...		Lus10017019 [exp]	14.0	0.8431
AT3G52390			TatD related DNase (.1.2)		Lus10013590 [exp]	15.2	0.8398
AT5G09500			Ribosomal protein S19 family p...		Lus10021886 [exp]	17.5	0.8199
AT4G19150			Ankyrin repeat family protein ...		Lus10001048 [exp]	19.0	0.7902
AT4G21800		QQT2	quatre-quart2, P-loop containi...		Lus10019602 [exp]	23.0	0.8146
AT1G51405			myosin-related (.1)		Lus10009954 [exp]	25.1	0.7720

Compare expression of checked genes

Lus10037857 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.