Gene [FLAX] | FIBexDB

Lus10037872 [FLAX]

External link

JGI Phytozome v13

[genome browser]

Symbol

Arabidopsis homologues

Show only best Show top 10

No hit found

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10020525 [exp]	69 / 3e-14	AT4G16950	66 / 2e-11	RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10026961 [exp]	67 / 2e-13	AT5G36930	420 / 2e-126	Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10020534 [exp]	64 / 3e-12	AT5G36930	414 / 1e-124	Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10020533 [exp]	57 / 8e-10	AT1G27170	405 / 1e-122	transmembrane receptors;ATP binding (.1.2)
Lus10035674 [exp]	53 / 2e-08	AT5G36930	410 / 1e-121	Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10034697 [exp]	49 / 3e-07	AT5G36930	300 / 2e-85	Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10020238 [exp]	49 / 4e-07	AT1G69550	391 / 7e-117	disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10038482 [exp]	48 / 7e-07	AT1G69550	386 / 3e-113	disease resistance protein (TIR-NBS-LRR class) (.1)
Lus10012311 [exp]	47 / 2e-06	AT5G36930	354 / 6e-103	Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.T005501 [exp]	44 / 3e-05	AT5G36930	612 / 0.0	Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.005G030700 [exp]	41 / 0.0002	AT1G69550	602 / 0.0	disease resistance protein (TIR-NBS-LRR class) (.1)
Potri.001G029300 [exp]	40 / 0.0005	AT3G14470	676 / 0.0	NB-ARC domain-containing disease resistance protein (.1)

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10037872 pacid=23163905 polypeptide=Lus10037872 locus=Lus10037872.g ID=Lus10037872.BGIv1.0 annot-version=v1.0

ATGTTACGCCAGGAATCCGGTCCGGATAGTACTTTCTGTAAAGATCTACAAAGGCTGTCGAATCTCAATAACCTGGCTAATCTGTCGACACTAGTCTTGA

AGGACGCTGGGATAGATGAGATTCTTGGTCTAGGAGAGCTCAAAATATTAGAGAATCTCGTGCTTCTCAAAGAGCTGAGAGTAGTAGGCTGTCCGGTCTT

AGAAAGGCTTACCAGCCTAGTAGCTTTAACCAAATTAGAGAGACTAGAGATTATAGATTGCCCGGTTCTCGTTGAAATCCATGGTGTGGGACAACTTTGG

GAATCTTTATCAGTTTTAGATGTGCGTGGATGTTCCGGCTTGACATGGTTGGAGACACTTGTTGGAATCTTTGGTACTTTGAGGATCCGAGTTAACAGAA

ACAGTACCGTCTTCACTTTCCATGTTCACCAAACTGACAAAGCTAGGTGTATTCGGTATGTCACGGAAACAGTTTCCTGA

AA sequence

Show only first row Show all

>Lus10037872 pacid=23163905 polypeptide=Lus10037872 locus=Lus10037872.g ID=Lus10037872.BGIv1.0 annot-version=v1.0

MLRQESGPDSTFCKDLQRLSNLNNLANLSTLVLKDAGIDEILGLGELKILENLVLLKELRVVGCPVLERLTSLVALTKLERLEIIDCPVLVEIHGVGQLW

ESLSVLDVRGCSGLTWLETLVGIFGTLRIRVNRNSTVFTFHVHQTDKARCIRYVTETVS

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44480		COG1, RPP10, RP...	recognition of peronospora par...		Lus10037872 [exp]	0	1

Lus10037872 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.