Lus10037874 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G63520 53 / 6e-09 ATNCED1, ATCCD1, CCD1 carotenoid cleavage dioxygenase 1 (.1)
AT1G78390 46 / 1e-06 ATNCED9, NCED9 nine-cis-epoxycarotenoid dioxygenase 9 (.1)
AT4G19170 43 / 2e-05 CCD4, NCED4 carotenoid cleavage dioxygenase 4, nine-cis-epoxycarotenoid dioxygenase 4 (.1)
AT1G30100 39 / 0.0008 ATNCED5, NCED5 nine-cis-epoxycarotenoid dioxygenase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009513 104 / 5e-27 AT3G63520 219 / 4e-64 carotenoid cleavage dioxygenase 1 (.1)
Lus10042829 87 / 2e-20 AT3G63520 207 / 2e-59 carotenoid cleavage dioxygenase 1 (.1)
Lus10037286 49 / 8e-08 AT4G19170 263 / 9e-86 carotenoid cleavage dioxygenase 4, nine-cis-epoxycarotenoid dioxygenase 4 (.1)
Lus10019710 48 / 5e-07 AT3G63520 842 / 0.0 carotenoid cleavage dioxygenase 1 (.1)
Lus10016410 47 / 2e-06 AT3G63520 842 / 0.0 carotenoid cleavage dioxygenase 1 (.1)
Lus10035696 46 / 2e-06 AT4G19170 813 / 0.0 carotenoid cleavage dioxygenase 4, nine-cis-epoxycarotenoid dioxygenase 4 (.1)
Lus10042481 44 / 7e-06 AT1G78390 271 / 2e-88 nine-cis-epoxycarotenoid dioxygenase 9 (.1)
Lus10029513 39 / 0.0005 AT3G63520 901 / 0.0 carotenoid cleavage dioxygenase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G042650 126 / 1e-34 AT3G63520 198 / 3e-56 carotenoid cleavage dioxygenase 1 (.1)
Potri.006G239402 114 / 2e-30 AT3G63520 208 / 1e-59 carotenoid cleavage dioxygenase 1 (.1)
Potri.018G043500 110 / 4e-29 AT3G63520 243 / 7e-73 carotenoid cleavage dioxygenase 1 (.1)
Potri.018G043000 110 / 7e-29 AT3G63520 236 / 5e-70 carotenoid cleavage dioxygenase 1 (.1)
Potri.006G239300 100 / 1e-25 AT3G63520 240 / 8e-72 carotenoid cleavage dioxygenase 1 (.1)
Potri.006G239200 86 / 2e-20 AT3G63520 135 / 3e-34 carotenoid cleavage dioxygenase 1 (.1)
Potri.019G093400 48 / 4e-07 AT4G19170 803 / 0.0 carotenoid cleavage dioxygenase 4, nine-cis-epoxycarotenoid dioxygenase 4 (.1)
Potri.005G069100 47 / 8e-07 AT4G19170 812 / 0.0 carotenoid cleavage dioxygenase 4, nine-cis-epoxycarotenoid dioxygenase 4 (.1)
Potri.001G393800 44 / 7e-06 AT3G14440 883 / 0.0 SALT TOLERANT 1, SUGAR INSENSITIVE 7, nine-cis-epoxycarotenoid dioxygenase 3 (.1)
Potri.009G060500 42 / 4e-05 AT3G63520 918 / 0.0 carotenoid cleavage dioxygenase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03055 RPE65 Retinal pigment epithelial membrane protein
Representative CDS sequence
>Lus10037874 pacid=23163669 polypeptide=Lus10037874 locus=Lus10037874.g ID=Lus10037874.BGIv1.0 annot-version=v1.0
ATGAAGACAGGAGAAGTGAAAGGGAAACCTCTTACAGGGCCTGATTTGTCCATGGACTTCCCAATCATCAATGACAACTTCACTGGGATCAAGCACAAGT
ATGCTTACACCTTAGTAGTTGACCCTTTGGCAAGTTCTGTAGCAGGCATGACTAAATATGGTGGTCTAGCTAAGTTGACAAACCTAAGAATGATGTTGAT
ATGCCTTGAATTATATATTATGATTAATATGGGGTTGAACTGGAACAAGGTGGAGGTTGAGCAACATAAGTTTCCAGAGCATGTATACTGCACTGGGAGT
GCCTTCGTCCCCAACCAGGAAAACCCACAGGAAGAAGATTCTGGTTGGATAATTAGTTATGTTCATGATGAAGAGAAGGACGTTGGTGTCCGTTCATTCT
ATTTCTATAGCTAG
AA sequence
>Lus10037874 pacid=23163669 polypeptide=Lus10037874 locus=Lus10037874.g ID=Lus10037874.BGIv1.0 annot-version=v1.0
MKTGEVKGKPLTGPDLSMDFPIINDNFTGIKHKYAYTLVVDPLASSVAGMTKYGGLAKLTNLRMMLICLELYIMINMGLNWNKVEVEQHKFPEHVYCTGS
AFVPNQENPQEEDSGWIISYVHDEEKDVGVRSFYFYS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G63520 ATNCED1, ATCCD1... carotenoid cleavage dioxygenas... Lus10037874 0 1
AT2G20420 ATP citrate lyase (ACL) family... Lus10022902 5.0 1.0000
Lus10022518 7.1 1.0000
Lus10022214 11.3 1.0000
Lus10003536 16.1 1.0000
AT5G22450 unknown protein Lus10000530 16.4 1.0000
AT4G17220 ATMAP70-5 microtubule-associated protein... Lus10003908 20.0 1.0000
Lus10011078 21.7 1.0000
Lus10011425 23.2 1.0000
Lus10011642 24.0 1.0000
Lus10011832 25.5 1.0000

Lus10037874 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.