Lus10037879 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27380 40 / 3e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038579 128 / 5e-40 AT4G27380 50 / 8e-09 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G406900 60 / 3e-13 AT4G27380 49 / 1e-08 unknown protein
PFAM info
Representative CDS sequence
>Lus10037879 pacid=23163802 polypeptide=Lus10037879 locus=Lus10037879.g ID=Lus10037879.BGIv1.0 annot-version=v1.0
ATGGCGAAAAACAGAAGCAAGAAGAAGACCACCGGCGCCGCTTCCATGGATGTATCAGAACCTACCGTCTCAGATGTTTCTCAAGCAATGGACACGTCGG
AGCCTGGAGCTTCGAGACCTCCTTCTAGTGGCCTCCACAGAATACAGAAGGGAAGACCGATGAAGAGATCGAAGAATGTTCGGAAGAAGAAGGCCCTGGC
AAAGGCCGTTTCGAAGTCGGAGAAGTCTGTCGAGAAAGTTGTCAAGCATGAGAATAAGAAACAAAGAACTCTATCTGCAAAGCAGCTTTATGACTAA
AA sequence
>Lus10037879 pacid=23163802 polypeptide=Lus10037879 locus=Lus10037879.g ID=Lus10037879.BGIv1.0 annot-version=v1.0
MAKNRSKKKTTGAASMDVSEPTVSDVSQAMDTSEPGASRPPSSGLHRIQKGRPMKRSKNVRKKKALAKAVSKSEKSVEKVVKHENKKQRTLSAKQLYD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G27380 unknown protein Lus10037879 0 1
AT2G36130 Cyclophilin-like peptidyl-prol... Lus10017010 7.5 0.8600
AT1G61620 phosphoinositide binding (.1) Lus10002584 9.5 0.8478
AT4G12790 P-loop containing nucleoside t... Lus10036411 15.4 0.8614
AT4G32930 unknown protein Lus10005503 17.2 0.8492
AT1G03330 Small nuclear ribonucleoprotei... Lus10029641 20.3 0.8394
AT1G03330 Small nuclear ribonucleoprotei... Lus10042686 22.8 0.8462
AT2G32080 PUR ALPHA-1, PU... purin-rich alpha 1 (.1.2) Lus10001782 24.8 0.8505
AT5G22080 Chaperone DnaJ-domain superfam... Lus10004099 26.1 0.8454
AT3G04780 Protein of unknown function (D... Lus10020246 28.1 0.8194
AT4G14110 FUS7, EMB143, C... FUSCA 7, EMBRYO DEFECTIVE 143,... Lus10005729 30.9 0.8164

Lus10037879 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.