Lus10037884 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038584 73 / 5e-17 AT4G27390 191 / 1e-60 unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10037884 pacid=23163818 polypeptide=Lus10037884 locus=Lus10037884.g ID=Lus10037884.BGIv1.0 annot-version=v1.0
ATGGCTAGGTCCACTGTCATGTTGTTTCTTGGTACCGTCTCTAATATGCACTTTCCATTGATCACAGTGGTAGATGACAAGTTTATCCGCGATTCTGTGA
GATTCACCGATGAGTCGACATCGTTCACAAAAGCCTTCAGGGGCTTTTACCCTGGCTCCGATCAAGGTGGGAAAGAACCATCTTCCTCTGCTGTAGTTGA
CGTTGAAGCAGAAGTAAAAGATGCAGACCGACGGATGCTTCAAATATCATACAATCTCGTAAACAACTAA
AA sequence
>Lus10037884 pacid=23163818 polypeptide=Lus10037884 locus=Lus10037884.g ID=Lus10037884.BGIv1.0 annot-version=v1.0
MARSTVMLFLGTVSNMHFPLITVVDDKFIRDSVRFTDESTSFTKAFRGFYPGSDQGGKEPSSSAVVDVEAEVKDADRRMLQISYNLVNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G27390 unknown protein Lus10037884 0 1
Lus10024550 7.9 0.9988
Lus10011497 8.0 0.9945
AT5G49720 TSD1, IRX2, DEC... TUMOROUS SHOOT DEVELOPMENT 1, ... Lus10028619 11.2 0.9988
AT1G48120 hydrolases;protein serine/thre... Lus10008569 13.7 0.9988
AT4G30880 Bifunctional inhibitor/lipid-t... Lus10016357 14.4 0.9572
Lus10033089 15.9 0.9988
AT5G13240 transcription regulators (.1) Lus10034638 16.1 0.9678
Lus10022145 17.7 0.9988
AT5G47180 Plant VAMP (vesicle-associated... Lus10000591 18.7 0.8529
Lus10023136 19.0 0.9518

Lus10037884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.