Lus10037889 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G47570 248 / 1e-76 Leucine-rich repeat protein kinase family protein (.1)
AT3G47090 246 / 9e-76 Leucine-rich repeat protein kinase family protein (.1)
AT3G47580 243 / 9e-75 Leucine-rich repeat protein kinase family protein (.1)
AT5G39390 232 / 4e-74 Leucine-rich repeat protein kinase family protein (.1)
AT3G47110 230 / 4e-70 Leucine-rich repeat protein kinase family protein (.1)
AT5G20480 228 / 4e-69 EFR EF-TU receptor (.1)
AT2G24130 147 / 8e-41 Leucine-rich receptor-like protein kinase family protein (.1)
AT5G25930 130 / 7e-35 Protein kinase family protein with leucine-rich repeat domain (.1)
AT2G19230 127 / 1e-33 Leucine-rich repeat transmembrane protein kinase protein (.1)
AT5G44700 126 / 2e-33 GSO2, EDA23 GASSHO 2, EMBRYO SAC DEVELOPMENT ARREST 23, Leucine-rich repeat transmembrane protein kinase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038598 286 / 1e-91 AT3G47570 671 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10004388 289 / 3e-90 AT3G47570 815 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10030638 278 / 1e-87 AT3G47570 771 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10016896 271 / 3e-85 AT3G47570 714 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10030903 270 / 1e-84 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10011388 269 / 2e-84 AT3G47570 757 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10030636 269 / 2e-84 AT3G47570 757 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10030851 268 / 3e-84 AT3G47570 748 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10030854 268 / 3e-84 AT3G47110 758 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G033900 274 / 1e-86 AT3G47570 786 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.011G102700 271 / 2e-85 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.019G100901 260 / 5e-85 AT5G39390 394 / 9e-133 Leucine-rich repeat protein kinase family protein (.1)
Potri.008G034000 271 / 6e-85 AT3G47570 827 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.008G007866 270 / 7e-85 AT3G47570 770 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.010G228200 269 / 3e-84 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.017G115900 268 / 6e-84 AT3G47570 810 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.011G102800 266 / 2e-83 AT3G47570 862 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.005G080000 265 / 8e-83 AT3G47570 818 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.011G103000 263 / 2e-82 AT3G47570 827 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10037889 pacid=23163660 polypeptide=Lus10037889 locus=Lus10037889.g ID=Lus10037889.BGIv1.0 annot-version=v1.0
ATGAGAAGTTTTGGTTCTGAGTACAAGGCGGTCATTGGAGAAAGCGGGACAACCATTGCTGTAAAGGTGTTCAACCTTGAGCGCCAAGGAGCTTCTAAGA
GTTTCATAGCAGAATGTGAAGCCTTAAGGAATATTAGACACAGAAACCTGATGAAGATAGTAACTGTTTGCTTGAGTGTTGATTACCATGGGAATGATTT
CAAAGCTGCTATTTATGAATATTTTGCTAATGGTCGGTTGGAAGAGTGGCTTCATCCAGAGGAGAGTAGCAATTCTTGTGACTTCCCTAGGAGACTGACT
TTTCTCCAGAGACTAAATGTTTCCATTGATGTAGCTTCAGCACTGGATTACCTTCATCACCAATGCCAAGTACCCTTAGCTCATTCTGATCTGAAGCCAA
GTAATATCCTTATCGACAACACCATGACAGCAGACATTGGTGATTTTGTGTTGGCAAGATTCCTGACATCAGTTTCAGAACCCTCTTCTGCAGAGCAGAC
AAGCTGTATTGGGTTGAAAGGAACTATTGGCTATGCTCCTCCTGAATATGGTACGGGAAATGAAGTGTCCATCCAAGGCGATGTATACAGCTATGGCATC
CTCCTACTTGAGAGTTGA
AA sequence
>Lus10037889 pacid=23163660 polypeptide=Lus10037889 locus=Lus10037889.g ID=Lus10037889.BGIv1.0 annot-version=v1.0
MRSFGSEYKAVIGESGTTIAVKVFNLERQGASKSFIAECEALRNIRHRNLMKIVTVCLSVDYHGNDFKAAIYEYFANGRLEEWLHPEESSNSCDFPRRLT
FLQRLNVSIDVASALDYLHHQCQVPLAHSDLKPSNILIDNTMTADIGDFVLARFLTSVSEPSSAEQTSCIGLKGTIGYAPPEYGTGNEVSIQGDVYSYGI
LLLES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G47570 Leucine-rich repeat protein ki... Lus10037889 0 1
AT5G24760 GroES-like zinc-binding dehydr... Lus10031319 7.7 0.8261
Lus10005604 8.7 0.7960
AT5G35730 EXS (ERD1/XPR1/SYG1) family pr... Lus10027149 13.2 0.7646
AT1G18640 PSP 3-phosphoserine phosphatase (.... Lus10021156 16.1 0.7140
AT3G27950 GDSL-like Lipase/Acylhydrolase... Lus10022233 36.7 0.7600
Lus10040057 40.1 0.7010
AT5G65980 Auxin efflux carrier family pr... Lus10035978 42.0 0.7138
AT5G51710 ATKEA5, KEA5 K+ efflux antiporter 5, ARABID... Lus10031687 45.7 0.7243
AT2G44220 Protein of Unknown Function (D... Lus10036998 54.8 0.7398
Lus10003428 71.0 0.7312

Lus10037889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.